KEGG   Mycobacterium tuberculosis H37Rv: Rv3221cHelp
Entry
Rv3221c           CDS       T00015                                 

Gene name
TB7.3
Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N HlyD_D23 GCV_H DUF2118 NQRA
Motif
Other DBs
NCBI-GeneID: 888096
NCBI-ProteinID: NP_217737
TubercuList: Rv3221c
UniProt: P9WPQ1 I6Y2Y9
Position
complement(3597551..3597766)
Genome map
AA seq 71 aa AA seqDB search
MAEDVRAEIVASVLEVVVNEGDQIDKGDVVVLLESMKMEIPVLAEAAGTVSKVAVSVGDV
IQAGDLIAVIS
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatgttcgcgccgagatcgtggccagcgttctcgaagtcgttgtcaacgaa
ggcgatcagatcgacaagggcgacgtcgtggtgctgctggagtcgatgaagatggagatc
cccgtcctggccgaagctgccggaacggtcagcaaggtggcggtatcggtgggcgatgtc
attcaggccggcgaccttatcgcggtgatcagctag

DBGET integrated database retrieval system