KEGG   Mycobacterium tuberculosis H37Rv: Rv3225cHelp
Entry
Rv3225c           CDS       T00015                                 

Definition
(RefSeq) GCN5-like N-acetyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Acetyltransf_3 Acetyltransf_1 Acetyltransf_10 Acetyltransf_8 FR47 RIO1
Motif
Other DBs
NCBI-GeneID: 888804
NCBI-ProteinID: NP_217742
TubercuList: Rv3225c
UniProt: O05841 L0TEZ9
Position
complement(3601016..3602440)
Genome map
AA seq 474 aa AA seqDB search
MRFAKLSDGLSDGIVTLSPLCLDDVDAHLAGGDERLVRWLSGMPSTRASVEAYIRHCREQ
WVTGGPLRSFGIRTVAETIVGTIDLRFDGEGLASGQVNVAYGLYPSWRGRGLATRAVDLV
CQYAAEHGATEAVIKVEPENSASARVALRAGFAFVRRICEQDGTVFDRYERVLRAKMHAD
EVDIDEDLVRRLLRAQFPQWADLPIAPVRSAGTDNAMYRLGEDLAVRIPRIGWAIESLRT
EQQWLPRIAAHLGVASPVPVGLGSPAEGFGWPWSVCRWVAGENPSAAEFVEPNRAVEDLA
DFITALRATDPMGGPPAKRGAPLGEQDAEVRAALAALDGIIDVHAATAAWESALRVPPYA
GPPMWFHGDLSRFNILTAQGRLTGVIDFGLMGVGDPSVDLIIAWNLLSAPARAQFRVAVG
AADDDWMRGRGRALAIALIALPYYQDTNPPLAASARYAIGEVLADFRYGARPGC
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctttgcgaagctgtccgacgggctatcagacgggatcgtcactctatcgccactg
tgcctggacgatgtcgatgcgcatctggctgggggggacgaacggctagtgcgttggctt
agcggtatgccctcgactcgagcaagcgtcgaagcgtacatccggcactgccgcgagcaa
tgggtgaccggcgggccgctgcgctctttcggcatcaggacggttgccgaaacaatagtg
ggtacgattgatctgcgtttcgacggcgaggggctggctagcgggcaggtcaacgttgcc
tatgggctctaccccagctggcgagggcgtggactcgccactcgcgcagtcgatctggtg
tgccagtatgcggccgaacacggcgcgaccgaagcggtgatcaaggtggagccggagaac
tccgcatcggcgagggtggcgttgcgggcgggctttgctttcgtgcggcggatctgtgag
caggacggaaccgtcttcgaccggtacgaacgtgtcctaagggcaaagatgcacgccgat
gaggtggatatcgacgaggatctggtgcggcgtctgctgcgtgcacaattcccacagtgg
gcggatctacccattgcaccggtgcgctcggcgggcacggacaacgcaatgtaccggcta
ggcgaggacctggccgtgcgcatcccgcgcattggctgggccatcgagagccttcggacc
gagcaacagtggctgccgcggatcgctgcgcatctaggcgttgccagcccagttccggtg
gggttggggagcccggctgaggggttcggttggccgtggtcagtgtgccgctgggttgcg
ggtgagaacccgtcggcagccgagttcgtcgagcccaatcgggccgtcgaggacctggct
gacttcatcaccgccttacgggccaccgaccccatgggcgggccgcccgccaagcggggt
gcgccgctgggggagcaggatgccgaggtacgcgcagcgctggcggccctcgacgggatc
atcgacgtccacgcggcaactgccgcgtgggaatcagccctacgcgttcctccgtatgcg
gggccgccgatgtggttccacggtgacctgtcccggttcaacatcctgacagcgcaagga
cgcttgacgggcgtcattgacttcggtctgatgggcgtcggtgaccccagcgtcgacttg
atcatcgcgtggaacctcctgtcggcgcccgcccgtgctcagttccgcgtcgcggtcggc
gccgccgacgacgactggatgcgcgggcgcggcagagctctggccatcgccttgatcgcg
ctcccgtactaccaagacaccaacccgccgctggcggccagcgcgcgctacgccatcggt
gaagtcctcgccgatttccggtacggcgctaggcccggatgttag

DBGET integrated database retrieval system