KEGG   Mycobacterium tuberculosis H37Rv: Rv3229cHelp
Entry
Rv3229c           CDS       T00015                                 

Gene name
desA3
Definition
(RefSeq) stearoyl-CoA 9-desaturase
  KO
K00508  
linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    Rv3229c (desA3)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     Rv3229c (desA3)
Lipid biosynthesis proteins [BR:mtu01004]
 Desaturase
  Front-end
   Rv3229c (desA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3605751..3607034)
Genome map
AA seq 427 aa AA seqDB search
MAITDVDVFAHLTDADIENLAAELDAIRRDVEESRGERDARYIRRTIAAQRALEVSGRLL
LAGSSRRLAWWTGALTLGVAKIIENMEIGHNVMHGQWDWMNDPEIHSSTWEWDMSGSSKH
WRYTHNFVHHKYTNILGMDDDVGYGMLRVTRDQRWKRYNIFNVVWNTILAIGFEWGVALQ
HLEIGKIFKGRADREAAKTRLREFSAKAGRQVFKDYVAFPALTSLSPGATYRSTLTANVV
ANVIRNVWSNAVIFCGHFPDGAEKFTKTDMIGEPKGQWYLRQMLGSANFNAGPALRFMSG
NLCHQIEHHLYPDLPSNRLHEISVRVREVCDRYDLPYTTGSFLVQYGKTWRTLAKLSLPD
KYLRDNADDAPETRSERMFAGLGPGFAGADPVTGRRRGLKTAIAAVRGRRRSKRMAKSVT
EPDDLAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcactgacgtcgacgtattcgcgcatctgacggacgccgacattgaaaacctg
gccgccgagctagatgccatccgccgagacgttgaagaatcgcgcggcgaacgcgatgcc
cgctacatccgccgcaccatcgccgcacagcgggcgctcgaggtgtccggtcggctactg
ctggctggcagctcacgacgcctcgcctggtggacaggtgccctgacccttggcgtggcc
aagatcatcgaaaacatggagatcggccacaacgtcatgcacggccagtgggactggatg
aacgacccggagattcactcctcgacgtgggagtgggacatgagcggatcgtccaagcac
tggcgctacacccacaacttcgtgcaccacaaatacaccaacatcctcggtatggatgac
gacgtcggatacggcatgctgcgcgtcacccgtgaccagcgctggaagcgctacaacatc
ttcaacgtggtgtggaacaccatccttgcgatcggcttcgagtggggagttgcgctgcag
cacttggagatcggcaagatcttcaagggtcgggccgaccgcgaggccgctaaaacccgg
ttgcgtgaattctcagccaaagcgggccgccaggtgttcaaggactatgtcgcgttcccg
gcgctgacctcgttgtccccgggggcgacgtatcggtccactttgaccgccaacgtggtg
gccaacgtgatccgcaacgtgtggtccaacgcggtgatcttctgcggccatttcccggat
ggcgcagagaaattcaccaagacggacatgatcggtgagccgaagggccagtggtaccta
cggcagatgctgggcagcgcaaacttcaacgctgggccggcgctgcggttcatgagcggc
aatctgtgccaccaaatcgagcatcacctctatccggacctgccgagcaaccggcttcac
gagatttcggtgcgggtgcgtgaggtctgcgacagatacgacttgccatacaccacgggc
tcgttcttggtgcagtacggcaagacctggcgcacccttgccaagctgtcgttgccggat
aagtacttacgtgacaacgctgacgatgcacccgagacccgcagtgagcggatgttcgct
ggtctggggccgggtttcgcgggcgccgatccggtgaccggacgtcgtcgggggttaaag
accgcgattgccgccgtgcggggtcggcggcgcagcaagcgtatggctaagtcggtcacc
gaacccgacgatctggcagcctaa

DBGET integrated database retrieval system