KEGG   Mycobacterium tuberculosis H37Rv: Rv3237cHelp
Entry
Rv3237c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K07228  
TrkA domain protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3613121..3613603)
Genome map
AA seq 160 aa AA seqDB search
MDVKEVLLPGVGLRYEFTSYRGDRIGIVARRSGGFDVVLYGRDDPDEARPVLRLTDEEAE
AVAQILGAPRIAERFTELTREVPGLKAGQIHIRAGSLFVDRPLGDTRARTRTGASIVAIV
RDEDVLASPGPTDVLRAGDVLIVIGTEDGIAGVEQIVEKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggaggtgctgctgccgggggtgggcctgcgatacgagttcaccagctat
cgcggtgaccggatcggcatcgttgccaggcgcagtggcggtttcgacgtcgtcctgtat
ggccgcgatgatccggacgaagcccgaccggttttgcggctcaccgatgaagaggccgag
gcggtggctcagattctgggtgcgccgaggatcgccgagcgatttaccgagctgacgcgt
gaggtgcccgggcttaaggccggtcagattcacatccgggcgggtagcttgtttgtggac
cggccgctgggtgatacccgtgcgcgcacccgtaccggcgcgtcgattgtggcgatcgtg
cgtgacgaggatgtgttggcctcgccgggcccgactgatgtgctgcgagccggagatgtc
ctcatcgtgatcggcaccgaggacgggatcgccggggtcgaacagatcgtcgaaaagggc
tga

DBGET integrated database retrieval system