KEGG   Mycobacterium tuberculosis H37Rv: Rv3252cHelp
Entry
Rv3252c           CDS       T00015                                 

Gene name
alkB
Definition
(RefSeq) transmembrane alkane 1-monooxygenase AlkB
  KO
K00496  
alkane 1-monooxygenase [EC:1.14.15.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Rv3252c (alkB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Rv3252c (alkB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.3  alkane 1-monooxygenase
     Rv3252c (alkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3630738..3631988)
Genome map
AA seq 416 aa AA seqDB search
MTTQIGSGGPEAPRPPEVEEWRDKKRYLWLMGLIAPTALVVMLPLIWGMNQLGWHAAAQV
PLWIGPILLYVLLPLLDLRFGPDGQNPPDEVTDRLENDKYYRYCTYIYIPFQYLSVVLGA
YLFTAANLSWLGFDGALSWAGKLGVALSVGVLGGVGINTAHEMGHKKDSLERWLSKITLA
QTCYGHFYIEHNRGHHVRVSTPEDPASARFGETLWEFLPRSVIGGLRSAVHLEAQRLRRL
GVSPWNPMTYLRNDVLNAWLMSVVLWGGLIAVFGPALIPFVIIQAVFGFSLLEAVNYLEH
YGLLRQKSANGRYERCAPVHSWNSDHIVTNLFLYHLQRHSDHHANPTRRYQTLRSMAGAP
NLPSGYASMISLTYFPPLWRKVMDHRVLEHYGGDITRVNLHPRVREKALARYGASA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcaaatcggctctggtggacccgaagccccccggccgcccgaagtcgaggag
tggcgggacaagaagcgttacctgtggcttatgggcctcatcgccccgacggccttggtg
gtgatgctgccgctgatctgggggatgaaccagctcggctggcacgccgccgcgcaggtg
ccgctgtggatcggaccgatcctgctctacgtcttgttgccgcttcttgacctacgcttc
gggcccgacgggcagaacccgcccgacgaggtgaccgaccggctggagaatgacaagtac
taccgctactgcacctacatctacatcccgttccagtacctcagcgtggtgctgggcgca
tacctgttcaccgccgcaaacctcagttggctcggctttgacggcgccttgagctgggcg
ggcaagcttggggtggcgctgtcggtcggtgtgcttggcggcgtcggtatcaacaccgcc
cacgaaatggggcacaagaaggattcgctggagcggtggctgtccaagatcaccctcgcc
cagacctgctacgggcacttctacatcgagcacaaccgtggccatcacgtccgggtgtcc
acaccggaggacccggcgtcggcgcggttcggcgagacgttgtgggagttcctgccccgc
agtgttatcggcggcttgcgctcggccgttcatttggaggcccaacggctgcgtcggctc
ggcgtcagcccctggaatcccatgacgtatctgcgcaacgacgtgctcaacgcgtggctg
atgtcggtggtgttgtggggtgggctgatcgcggtcttcggcccggcgctgatcccgttc
gtcatcatccaggcagtcttcggcttcagcctgttagaggccgtcaactacctcgaacac
tacggactgctacggcagaagagcgccaacggccgctacgagcgctgcgccccggtgcac
agctggaactccgaccacatcgtcaccaacctgttcctctaccacctgcagcgacacagc
gatcaccacgccaaccccactcgccgctatcagacactgcggagcatggcgggtgcgccc
aacctgcccagtgggtatgcatcgatgatctcgctgacctacttcccgccgttgtggcgc
aaggtaatggatcaccgggtgctggagcactacggcggcgatatcactcgggttaacctg
cacccgcgcgtgcgggagaaggcactcgcccgttacggagcctcggcatga

DBGET integrated database retrieval system