KEGG   Mycobacterium tuberculosis H37Rv: Rv3254Help
Entry
Rv3254            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Trp_halogenase FAD_binding_3 NAD_binding_8 FAD_binding_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 887237
NCBI-ProteinID: NP_217771
TubercuList: Rv3254
UniProt: O05897
Position
3633675..3635063
Genome map
AA seq 462 aa AA seqDB search
MVIGASIAGLCAARVLSDFYSTVTVFERDELPEAPANRATVPQDRHLHMLMARGAQEFDS
LFPGLLHDMVAAGVPMLENRPDCIYLGAAGHVLGTGHTLRKEFTAYVPSRPHLEWQLRRR
VLQLSNVQIVRRLVTEPQFERRQQRVVGVLLDSPGSGQDREREEFIAADLVVDAAGRGTR
LPVWLTQWGYRRPAEDTVDIGISYASHQFRIPDGLIAEKVVVAGASHDQSLGLGMLCYED
GTWVLTTFGVADAKPPPTFDEMRALADKLLPARFTAALAQAQPIGCPAFHAFPASRWRRY
DKLERFPRGIVPFGDAVASFNPTFGQGMTMTSLQAGHLRRALKARNSAMKGDLAAELNRA
TAKTTYPVWMMNAIGDISFHHATAEPLPRWWRPAGSLFDQFLGAAETDPVLAEWFLRRFS
LLDSLYMVPSVPIIGRAIAHNLRLWLKEQRERRQPVTTRRSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcggagctagcatcgccgggttgtgcgccgcgcgggtgctctcggacttctac
tccacggtgacggttttcgagcgcgacgagttgccggaagcgccggcgaaccgggccacg
gtccctcaagaccgacacctgcacatgttgatggcccgcggggcgcaggaattcgacagc
ctgttccccggcctgttgcacgacatggtggccgcgggcgtgcccatgcttgagaaccgg
ccggactgtatctacttgggcgccgccggccatgtcctcgggacggggcataccctgcgc
aaggagttcaccgcctacgtgcccagccggccgcacctggaatggcagctgcggcgacgg
gtcctgcagctctccaacgtccagattgtgcggcgcctggtcaccgagccacagttcgag
cgcaggcagcagcgagtggtcggcgtgctgctggattcccctggtagcggccaagatcgg
gaacgcgaagagttcatagctgccgaccttgtcgtcgacgcagccggccggggtacccga
ctgccggtttggttgacgcagtggggatatcggcggccggccgaagacaccgtggacatc
ggcatcagctatgccagccaccaatttcgcattcccgacgggctgatcgccgagaaggtg
gtggtcgccggcgcctcacacgatcagtcgctggggctaggcatgctgtgctacgaggac
ggcacctgggtcctcaccaccttcggggtggccgatgccaaaccgccgccgactttcgac
gagatgcgtgcactcgcggacaaactgctgccggcccgcttcaccgccgcgctggcgcaa
gcccaaccgatcggctgtccggcgtttcatgctttcccagccagcagatggcgtcgctac
gacaagctggaacgtttcccgcgcggaatcgtcccgttcggcgatgcggtggccagcttc
aatcccaccttcgggcagggcatgacgatgacctcactgcaagccggccacctacgacgg
gcgctcaaagcccgcaactcagctatgaaaggcgacctggccgccgaactcaatcgggcc
accgccaagaccacctatccggtgtggatgatgaacgcaatcggcgacatcagtttccac
cacgccaccgctgagccccttccccgatggtggcgcccagccggttcgctgttcgaccaa
ttcctcggggccgcagaaaccgatcctgttctcgccgaatggtttctgcgacggttttcg
ctgctggacagcctgtacatggtgccgtcggtaccgatcatcggtcgcgccattgctcac
aatctgcgattgtggctaaaagagcagcgtgagcgtcggcaacccgtcacaacccgacgg
tcgccctga

DBGET integrated database retrieval system