KEGG   Mycobacterium tuberculosis H37Rv: Rv3262Help
Entry
Rv3262            CDS       T00015                                 

Gene name
fbiB
Definition
Probable F420 biosynthesis protein FbiB
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mtu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3641535..3642881
Genome map
AA seq 448 aa AA seqDB search
MTGPEHGSASTIEILPVIGLPEFRPGDDLSAAVAAAAPWLRDGDVVVVTSKVVSKCEGRL
VPAPEDPEQRDRLRRKLIEDEAVRVLARKDRTLITENRLGLVQAAAGVDGSNVGRSELAL
LPVDPDASAATLRAGLRERLGVTVAVVITDTMGRAWRNGQTDAAVGAAGLAVLRNYAGVR
DPYGNELVVTEVAVADEIAAAADLVKGKLTATPVAVVRGFGVSDDGSTARQLLRPGANDL
FWLGTAEALELGRQQAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHTRPTRFVWL
QTPAIRARLLDRMKDKWRSDLTSDGLPADAIERRVARGQILYDAPEVVIPMLVPDGAHSY
PDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGSTIFAADLVRDELDLPVDWEP
LGAIAIGYADEPSGLRDPVPAADLLILK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggccccgaacatggctccgcctcgaccatcgagatcctgcccgtcatcgggctg
cccgaattccgtcccggcgacgatctgagcgccgccgtcgccgcggcggcaccgtggcta
cgcgacggtgacgtcgtggtggttaccagcaaggtggtgtccaaatgcgagggccggctg
gttccggctcccgaagaccccgagcaaagagaccgattgcgccgcaagctgatcgaggat
gaggcagtgcgcgtgttggcgcgcaaggaccgcacgttgatcaccgagaatcgactcggg
ctggttcaggcggccgccggcgtggacggatccaacgtcggccggtccgagttagcgctg
ctgccggtcgatcctgacgccagtgccgcaaccttgcgcgccgggctgcgcgagcggctc
ggcgtcaccgtcgccgtggtcatcaccgacaccatgggacgcgcctggcgcaacggccag
accgatgccgcagtcggcgctgccggtctggcggtgctgcgcaactatgccggtgtccgc
gacccatacggcaatgagttggtggtcaccgaggtcgcagtcgccgacgagatcgccgcg
gccgccgacttggtcaaaggcaaactgaccgcgacgccggtggcggtggtgcgtgggttc
ggcgtgtccgacgacggctcgacagcccggcaactgctgcggccgggcgccaacgacctg
ttctggctcgggaccgccgaagcgctcgagctgggtcgccagcaagcccaactgttgcgc
aggtccgttcgccggtttagcaccgatccggtgccgggcgacctcgtcgaggctgcggtc
gccgaggccctcaccgcgccagccccacatcacacccggccgacccgattcgtgtggctg
cagacaccggccatccgcgcgcggctgctagatcggatgaaagacaagtggcggtctgat
ctcaccagtgacggcttgcccgccgacgcgatagaacgccgggtggcacgcggccagatc
ctctatgacgcacccgaagtcgtcataccgatgctggtgcccgacggagcacacagctac
cccgatgccgcccgcaccgacgccgagcacaccatgttcacggtcgccgtcggagcggcc
gtacaagccttgctggtcgcgctggccgtgcgcgggctgggcagttgctggatcggctcg
acgatctttgccgctgacctggtccgcgacgagctggacctgccagtcgactgggagccg
ttgggcgccatcgcgatcggatatgccgacgagccgtccgggttgcgcgacccggtgcct
gccgccgatttgctgatcctgaagtga

DBGET integrated database retrieval system