KEGG   Mycobacterium tuberculosis H37Rv: Rv3268Help
Entry
Rv3268            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3649420..3650109
Genome map
AA seq 229 aa AA seqDB search
MLRADPVGPRITYYDDATGERIELSAVTLANWAAKTGNLLRDELAAGPASRVAILLPAHW
QTAAVLFGVWWIGAQAILDDSPADVALCTADRLAEADAVVNSAAVAGEVAVLSLDPFGRP
ATGLPVGVTDYATAVRVHGDQIVPEHNPGPVLAGRSVEQILRDCAASAAARGLTAADRVL
STASWAGPDELVDGLLAILAAGASLVQVANPDPAMLQRRIATEKVTRVL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgacccggtcggcccgcgcatcacctactatgacgatgccaccggtgag
cgcatcgagctatccgcggtgacactggctaactgggccgccaagaccggcaacctgttg
cgcgacgagctggcggccggacccgccagccgagtcgcgatcctattaccggcccattgg
cagaccgcggcggtgttgttcggcgtgtggtggatcggtgcgcaagcgatactcgacgat
tctcccgccgatgtggcactgtgcaccgccgaccgtctggccgaagccgacgccgtcgtc
aacagcgcggcggtagccggcgaggtagccgtgctgtcgctggatccattcggtcgaccg
gcaaccggcctgccggtcggcgtcaccgactatgcgaccgcggtgcgggtacacggcgac
cagatagttcccgaacacaaccccggtccggtgcttgccggtagatccgtcgagcagatc
ctgcgcgactgcgcggcgtccgcggccgccaggggtttgacggcggcggatcgggtgctg
tccaccgcttcctgggccggacccgatgagttggtggacggcctgctggcgatcctggcc
gccggtgcgtcgttggtgcaggtggccaatcccgatccggcgatgctgcagcgcaggatt
gcgaccgaaaaggtcacccgcgtcctgtga

DBGET integrated database retrieval system