KEGG   Mycobacterium tuberculosis H37Rv: Rv3277Help
Entry
Rv3277            CDS       T00015                                 

Definition
(RefSeq) transmembrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GtrA
Motif
Other DBs
NCBI-GeneID: 888729
NCBI-ProteinID: NP_217794
TubercuList: Rv3277
UniProt: P96882 A0A089SAM8
Position
3659878..3660696
Genome map
AA seq 272 aa AA seqDB search
MNEVTAGVRELATAIMVSRHLTGVLAGHGSQTVTYHFASILCSSVHSLVVSFADATIARL
PGVVQPYAQRHHELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASY
VLNREWSFRDRGGRERHHEALLFFAFSGVGVLLSMAPLWFSSYILQLRVPTVSLTMENIA
DFISAYIIGNLLQMAFRFWAFRRWVFPDEFARNPDKALESALTAGGIAEVFEDVLEGGFE
DGNVTLLRAWRNRANRFAQLGDSSEPRVSKTS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtgaccgccggggtgcgtgagctcgccacggccatcatggtgtcacggcat
ctgaccggcgtacttgccggccacggcagccaaaccgttacgtatcattttgcgtcgatt
ttgtgttcgtccgtacactcacttgttgtgtcctttgccgatgccaccatcgcgcgcctt
cccggggtggtccagccctatgcgcagcgccaccatgagctgatcaaatttgccatcgtc
ggcggcaccacattcatcatcgacacagcaattttctacaccctcaagctgacggttctc
gaacccaagccggtgaccgcgaaggtgatcgccggcatcgtcgccgtcatcgcgtcctac
gtgttgaacagggagtggagcttccgcgaccgcggcggtcgcgagcgccaccatgaggcg
ctgctgttctttgcgttcagcggcgtgggagtgctgctgagcatggcgccgttgtggttt
tccagctacatcctgcagctacgggtgccaacggtgtcactgaccatggaaaacatcgcc
gacttcatctcggcctacattattggcaacttgctgcaaatggcgttccgcttctgggcg
tttcggcgctgggtgttccccgacgagttcgcccgcaaccccgacaaggccctggaatcc
gcccttaccgcgggcggcatcgccgaagtcttcgaggacgtcttggagggcggcttcgag
gacggcaacgtcaccctgctgcgggcctggcgtaaccgggccaaccggttcgctcagctg
ggcgactcgtcggagcccagggtgtcgaaaacctcgtga

DBGET integrated database retrieval system