KEGG   Mycobacterium tuberculosis H37Rv: Rv3465Help
Entry
Rv3465            CDS       T00015                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rv3465 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv3465 (rmlC)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rv3465 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3882834..3883442
Genome map
AA seq 202 aa AA seqDB search
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG
LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG
FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV
RASGLLPRWEQTQRFIGEMRGT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacgcgaactcgacgtccccggcgcctgggagattaccccgaccatccatgtc
gattcccgcggactgttcttcgaatggcttaccgatcatgggttccgcgcattcgcaggt
cacagtttggacgtccggcaagtgaactgctcggtgtcatcggccggtgtgctgcgcggc
ctgcactttgcccagttgccgccgagccaggccaagtatgtgacctgcgtttccggctcg
gtgttcgatgtcgtcgtcgacatccgagagggctcaccgacattcggccgatgggactcg
gtgctgctcgacgaccaagaccgtaggacgatctacgtctccgaaggcctagcgcacggc
ttccttgcactgcaagacaattcgacggtgatgtacttgtgctcggcggaatacaatccg
cagcgcgagcacaccatctgcgccacagatccgacgttggcggtcgattggccgctggtc
gatggcgctgcccccagcctgtccgaccgtgatgccgctgcgcccagcttcgaggatgtg
cgcgcgtctggcctgctgcccaggtgggaacagacgcagcggttcattggggagatgcgc
ggcacctag

DBGET integrated database retrieval system