KEGG   Mycobacterium tuberculosis H37Rv: Rv3515cHelp
Entry
Rv3515c           CDS       T00015                                 

Gene name
fadD19
Definition
(RefSeq) acyl-CoA synthetase
  KO
K18688  3-oxocholest-4-en-26-oate---CoA ligase [EC:6.2.1.42]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.42  3-oxocholest-4-en-26-oate---CoA ligase
     Rv3515c (fadD19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 888275
NCBI-ProteinID: YP_177983
TubercuList: Rv3515c
UniProt: P9WQ51 I6YCB1
Position
complement(3950824..3952470)
Genome map
AA seq 548 aa AA seqDB search
MAVALNIADLAEHAIDAVPDRVAVICGDEQLTYAQLEDKANRLAHHLIDQGVQKDDKVGL
YCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELRYLFDNSDMVALVHERRYADRVANVL
PDTPHVRTILVVEDGSDQDYRRYGGVEFYSAIAAGSPERDFGERSADAIYLLYTGGTTGF
PKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAANPPMIRYPIPPMIHGATQSAT
WMALFSGQTTVLAPEFNADEVWRTIHKHKVNLLFFTGDAMARPLVDALVKGNDYDLSSLF
LLASTAALFSPSIKEKLLELLPNRVITDSIGSSETGFGGTSVVAAGQAHGGGPRVRIDHR
TVVLDDDGNEVKPGSGMRGVIAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVE
EDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQA
RPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVH
AGHVTSGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtggccctgaatattgccgatctcgccgagcacgccatcgacgccgtgcctgac
cgtgtcgccgttatctgcggcgatgagcagttgacctacgcccagctggaggataaggcc
aaccgcctcgcgcaccacctgatcgatcaaggcgtgcaaaaggacgacaaggtcggcctg
tactgccgcaaccgcatcgagatcgtgatcgcgatgctgggcatcgtgaaggcgggcgcc
atcttggtgaacgtcaacttccgttacgtggagggcgaacttcgctacctgttcgacaac
tccgacatggtcgcgttggtgcacgaacgccgctacgccgaccgggtcgccaacgttctc
cccgacacgccccatgtaaggacgatcttggtcgtcgaggacggctcggaccaggactat
cggcgctacggcggcgtcgagttctattccgcgatcgcggcgggctcgccggagcgtgac
ttcggcgaacgcagcgccgacgccatctatctgctctacaccggcggcaccaccggtttc
cccaagggtgtgatgtggcgtcacgaggacatctatcgtgtgctgttcggtggaaccgac
tttgcgacaggagagttcgtcaaagacgaatacgacctggccaaggcggccgcggcgaat
ccaccgatgatccgctacccgatcccgccgatgatccacggcgccacccagtcggccacc
tggatggcgctcttctcgggccaaaccacggtactggcaccggaattcaacgccgacgag
gtgtggcgcacgatccacaaacacaaggtgaacctgctgttcttcaccggtgatgcgatg
gcccgcccgctggtcgacgcgctggtcaagggcaacgactacgacctgtcgtcgttgttc
ctgttggccagcaccgcggcgctgttctcgccgagcatcaaggagaaactccttgagctg
ctgccgaatcgggtgatcacggactcaattggctcgtcggagacgggttttggcggtacc
agcgtcgttgctgccgggcaggcgcatggcggcgggccccgggtgcggatcgaccatcgc
accgtcgtgctcgatgacgacggcaacgaagtcaagcccggctcggggatgcggggcgtc
atcgccaagaagggcaacattcccgtcggctactacaaggacgagaagaagacggccgag
acgttccggacgattaacggtgtgcgctacgccattccgggggactacgcccaagtcgag
gaggacggcacggtcaccatgctgggtcgtggctcggtgtcgatcaacagcggcggcgag
aaggtctaccccgaagaggtcgaggccgctttgaaggggcatcccgacgtgttcgacgct
ctggtggtcggggtgcccgatccgcgttacggccagcaggtggccgccgtggtgcaggcc
cggccgggttgtcggccgtcgttggccgagttggactcgttcgtgcgctccgagatcgcg
ggctacaaagtgccgcgcagtctgtggtttgtcgacgaggtgaagcgttcgcccgccggt
aagccggactaccgctgggccaaggagcagaccgaggcgcggccagccgatgacgtgcat
gcgggacacgtgacgagcggtgggtga

DBGET integrated database retrieval system