KEGG   Mycobacterium tuberculosis H37Rv: Rv3515cHelp
Entry
Rv3515c           CDS       T00015                                 

Gene name
fadD19
Definition
Fatty-acid-CoA ligase FadD19 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
Orthology
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3950824..3952470)
Genome map
AA seq 548 aa AA seqDB search
MAVALNIADLAEHAIDAVPDRVAVICGDEQLTYAQLEDKANRLAHHLIDQGVQKDDKVGL
YCRNRIEIVIAMLGIVKAGAILVNVNFRYVEGELRYLFDNSDMVALVHERRYADRVANVL
PDTPHVRTILVVEDGSDQDYRRYGGVEFYSAIAAGSPERDFGERSADAIYLLYTGGTTGF
PKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAANPPMIRYPIPPMIHGATQSAT
WMALFSGQTTVLAPEFNADEVWRTIHKHKVNLLFFTGDAMARPLVDALVKGNDYDLSSLF
LLASTAALFSPSIKEKLLELLPNRVITDSIGSSETGFGGTSVVAAGQAHGGGPRVRIDHR
TVVLDDDGNEVKPGSGMRGVIAKKGNIPVGYYKDEKKTAETFRTINGVRYAIPGDYAQVE
EDGTVTMLGRGSVSINSGGEKVYPEEVEAALKGHPDVFDALVVGVPDPRYGQQVAAVVQA
RPGCRPSLAELDSFVRSEIAGYKVPRSLWFVDEVKRSPAGKPDYRWAKEQTEARPADDVH
AGHVTSGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtggccctgaatattgccgatctcgccgagcacgccatcgacgccgtgcctgac
cgtgtcgccgttatctgcggcgatgagcagttgacctacgcccagctggaggataaggcc
aaccgcctcgcgcaccacctgatcgatcaaggcgtgcaaaaggacgacaaggtcggcctg
tactgccgcaaccgcatcgagatcgtgatcgcgatgctgggcatcgtgaaggcgggcgcc
atcttggtgaacgtcaacttccgttacgtggagggcgaacttcgctacctgttcgacaac
tccgacatggtcgcgttggtgcacgaacgccgctacgccgaccgggtcgccaacgttctc
cccgacacgccccatgtaaggacgatcttggtcgtcgaggacggctcggaccaggactat
cggcgctacggcggcgtcgagttctattccgcgatcgcggcgggctcgccggagcgtgac
ttcggcgaacgcagcgccgacgccatctatctgctctacaccggcggcaccaccggtttc
cccaagggtgtgatgtggcgtcacgaggacatctatcgtgtgctgttcggtggaaccgac
tttgcgacaggagagttcgtcaaagacgaatacgacctggccaaggcggccgcggcgaat
ccaccgatgatccgctacccgatcccgccgatgatccacggcgccacccagtcggccacc
tggatggcgctcttctcgggccaaaccacggtactggcaccggaattcaacgccgacgag
gtgtggcgcacgatccacaaacacaaggtgaacctgctgttcttcaccggtgatgcgatg
gcccgcccgctggtcgacgcgctggtcaagggcaacgactacgacctgtcgtcgttgttc
ctgttggccagcaccgcggcgctgttctcgccgagcatcaaggagaaactccttgagctg
ctgccgaatcgggtgatcacggactcaattggctcgtcggagacgggttttggcggtacc
agcgtcgttgctgccgggcaggcgcatggcggcgggccccgggtgcggatcgaccatcgc
accgtcgtgctcgatgacgacggcaacgaagtcaagcccggctcggggatgcggggcgtc
atcgccaagaagggcaacattcccgtcggctactacaaggacgagaagaagacggccgag
acgttccggacgattaacggtgtgcgctacgccattccgggggactacgcccaagtcgag
gaggacggcacggtcaccatgctgggtcgtggctcggtgtcgatcaacagcggcggcgag
aaggtctaccccgaagaggtcgaggccgctttgaaggggcatcccgacgtgttcgacgct
ctggtggtcggggtgcccgatccgcgttacggccagcaggtggccgccgtggtgcaggcc
cggccgggttgtcggccgtcgttggccgagttggactcgttcgtgcgctccgagatcgcg
ggctacaaagtgccgcgcagtctgtggtttgtcgacgaggtgaagcgttcgcccgccggt
aagccggactaccgctgggccaaggagcagaccgaggcgcggccagccgatgacgtgcat
gcgggacacgtgacgagcggtgggtga

DBGET integrated database retrieval system