KEGG   Mycobacterium tuberculosis H37Rv: Rv3608cHelp
Entry
Rv3608c           CDS       T00015                                 

Gene name
folP1
Definition
Dihydropteroate synthase 1 FolP (DHPS 1) (dihydropteroate pyrophosphorylase 1) (dihydropteroate diphosphorylase 1)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4049138..4049980)
Genome map
AA seq 280 aa AA seqDB search
MSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRV
DPAVETSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLL
AEADVPWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGL
GFAKTAQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVI
SALAALHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccggcgcccgtgcaggtgatgggggttctaaacgtcacggacgactctttctcg
gacggcgggtgttatctcgatctcgacgatgcggtgaagcacggtctggcgatggcagcc
gcaggtgcgggcatcgtcgacgtcggtggtgagtcgagccggcccggtgccactcgggtt
gacccggcggtggagacgtctcgtgtcatacccgtcgtcaaagagcttgcagcacaaggc
atcaccgtcagcatcgataccatgcgcgcggatgtcgctcgggcggcgttgcagaacggt
gcccagatggtcaacgacgtgtcgggtgggcgggccgatccggcgatggggccgctgttg
gccgaggccgatgtgccgtgggtgttgatgcactggcgggcggtatcggccgataccccg
catgtgcctgtgcgctacggcaacgtggtggccgaggtccgtgccgacctgctggccagc
gtcgccgacgcggtggccgcaggcgtcgacccggcaaggctggtgctcgatcccgggctt
ggattcgccaagacggcgcaacataattgggcgatcttgcatgcccttccggaactggtc
gcgaccggaatcccagtgctggtgggtgcttcgcgcaagcgcttcctcggtgcgttgttg
gccgggcccgacggcgtgatgcggccaaccgatgggcgtgacaccgcgacggcggtgatt
tccgcgctggccgcactgcacggggcctggggtgtgcgggtgcatgatgtgcgggcctcg
gtcgatgccatcaaggtggtcgaagcgtggatgggagcggaaaggatagaacgcgatggc
tga

DBGET integrated database retrieval system