KEGG   Mycobacterium tuberculosis H37Rv: Rv3696cHelp
Entry
Rv3696c           CDS       T00015                                 

Gene name
glpK
Definition
Probable glycerol kinase GlpK (ATP:glycerol 3-phosphotransferase) (glycerokinase) (GK)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mtu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(4138202..4139755)
Genome map
AA seq 517 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGVHVTDVTNASRTMLMDLETLDWDDELLSLFSIPRAMLPEIASSAPSEPY
GVTLATGPVGGEVPITGVLGDQHAAMVGQVCLAPGEAKNTYGTGNFLLLNTGETIVRSNN
GLLTTVCYQFGNAKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVPDNGGMY
FVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVRL
QVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALGVAYAAGLAVGFWAAPSDLRAN
WREDKRWTPTWDDDERAAGYAGWRKAVQRTLDWVDVS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccaacgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgattgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacttatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcgggggggtgtgcatgtcaccgatgtaaccaacgcc
agccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcgttg
ttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagccttac
ggtgtcacgctggcgaccgggcctgtcggcggtgaggtgccgatcaccggagttctcggt
gatcagcatgcggccatggtcggtcaagtctgtctggccccaggggaggcgaaaaacacc
tatgggaccggcaattttctgctgctgaacaccggtgaaacgatcgtgcgatcgaataac
ggcctgctaaccacggtgtgctaccaattcgggaacgctaaacccgtgtacgcgcttgaa
ggttcgatcgcggtgaccggctcggcggtgcagtggctacgcgatcagctgggcatcatc
agcggcgccgcacagagtgaggcgctggcccgccaggtccccgacaacggcggcatgtat
ttcgtgccggcgttttccgggctgttcgcgccatactggcggtccgatgcgcgcggcgcg
atcgtcgggttgtcgcggttcaacaccaacgcgcacctggcgcgcgcaacgctggaggcg
atctgctaccagagccgcgatgtggtggacgccatggaagcagactccggtgttcgcctg
caggtgttgaaggtggatggcgggatcaccggcaacgacctgtgtatgcagatccaggcc
gacgtgttgggtgtggatgtggtgcggccggtggtcgccgagaccaccgcactaggtgtg
gcctacgcggcgggcttggcggtcgggttctgggcggctccgtccgatctgcgggccaac
tggcgagaggacaagcggtggacaccgacgtgggacgacgacgagcgtgccgcgggttat
gccggctggcgcaaggcggtgcagcggaccctggattgggttgacgtgtcctag

DBGET integrated database retrieval system