KEGG   Mycobacterium tuberculosis H37Rv: Rv3715cHelp
Entry
Rv3715c           CDS       T00015                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rv3715c (recR)
DNA repair and recombination proteins [BR:mtu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Rv3715c (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rv3715c (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 IMS_HHH zinc_ribbon_2 HHH_3
Motif
Other DBs
NCBI-GeneID: 885307
NCBI-ProteinID: NP_218232
TubercuList: Rv3715c
UniProt: P9WHI3 I6X859
Position
complement(4159889..4160500)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCG
NVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRVLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacccgtccaggacctgattgacgaactcggcaagttgccggggatcgga
cccaagagtgcgcagcgaatcgccttccacctgttgtcggtagaaccgtcggacatcgac
cggctgaccggtgtgctggcgaaggttcgggacggcgtgcgattctgcgcggtgtgtggg
aatgtctctgacaacgagcgttgcagaatctgctctgatatccgtcgcgatgcgtccgtg
gtgtgcattgtcgaggaacccaaagacatccaggccgtcgagcgcacccgcgagttccgg
ggtcgctatcacgtcctgggcggggcgcttgacccgctgtccggaattgggccggatcag
ctgcggatccgcgaactgctgagccgcatcggggaacgggtcgacgacgtcgacgtcacc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggcgacggccacctacctggtg
cgaatgctgcgcgacatccccggcctgaccgtcacacggatcgcgtccgggctgccgatg
ggcggtgacctggaattcgccgacgagctcaccctgggccgagcgctcgccggccgccgc
gtgctcgcctga

DBGET integrated database retrieval system