KEGG   Mycobacterium tuberculosis 7199-99: MT7199_0525Help
Entry
MT7199_0525       CDS       T02617                                 

Definition
putative UROPORPHYRIN-III C-METHYLTRANSFERASE HEMD (UROPORPHYRINOGEN III METHYLASE) (UROGEN III METHYLASE) (SUMT) (UROGEN III METHYLASE) (UROM) (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mtub00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606940..608637
Genome map
AA seq 565 aa AA seqDB search
MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVVALIGTDLPPV
SGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEARSGV
DVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVADVR
IDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVE
TTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLV
PRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNA
VRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPP
YDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVD
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctccggtccgggc
gaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcgctggtgttc
accgatcccgacgtaccggagccggtggtggcgctgatcggcacggatctgccccccgtg
tccggcccggcgcccgccgagccggttgccgggaacggcgatgcggccggcggaggaagt
gcgcaggaacacggccgggccgcgtccgcggtagtctccggtggtcctgacatccgcccg
gcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgttcgggtgtc
gacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatcagcgaggtg
aacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggccgccagcagc
gcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgccgacgtgcgt
atcgaccccgaaaacaccgactgggacgcgctggctgccgcacccgggccgctgatcctg
caggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggcc
gagtccactccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgttcggtcgag
accacacttcagggattgaccgacccggccgtcctgggcgctaccgaccccgcgtgctcc
gcaaacgggagggactcccaggccggaccgctgatagtgaccatcggcaagacggtgacc
agtcgggcaaagctgaactggtgggagagccgcgccctctacggctggacggtgttggtg
ccgcgcaccaaggaccaggccggcgagatgagcgagcggctcacgtcgtacggcgcgctg
ccggtggaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgc
gccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcg
gtgcgtgcggtgtgggagaagttcggcgagttcggtctggatgcccgcgcgttctccggg
gtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttcggaatcagt
cccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccc
tacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccacc
gaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctac
cggaccgtgcgggccgcgccgccgccggccactacccgggaaatgatcaagacgggcggg
tttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggc
aagccgcacgcgcggacgatcatcgcctgcatagggccaaagaccgccgagaccgcagcc
gagttcggcttgcgggtcgatgtccagccggacaccgccgccatcggcccgctggtcgat
gcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaag
aagagccgcaggcgctag

DBGET integrated database retrieval system