KEGG   Mycobacterium tuberculosis 7199-99: MT7199_0963Help
Entry
MT7199_0963       CDS       T02617                                 

Definition
putative FORMAMIDOPYRIMIDINE-DNA GLYCOSYLASE (FAPY-DNA GLYCOSYLASE) (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtub03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057081..1057557
Genome map
AA seq 158 aa AA seqDB search
MAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKI
SPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPV
CGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggccgggacgccgcagccgcgcgcgctcgggcccgatgcgctggacgtcagcaccgac
gacctggccgggctgttggccggcaacaccggccggatcaagaccgtcatcaccgaccag
aaggtaattgccggcatcggcaacgcctatagtgacgaaatcctgcacgtcgcgaagatc
tcgccgttcgccacggccggcaagttatccggcgcacagctcacctgcctgcatgaggcg
atggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccagggcgcggccatgctc
aaaggggagaaacgttctgggcttcgagtacatgcgcgcaccgggttaccctgcccagtg
tgcggtgacaccgtgcgggaggtgtccttcgcggacaagtcttttcagtactgtccaacg
tgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcggctgctcaagtag

DBGET integrated database retrieval system