KEGG   Mycobacterium tuberculosis 7199-99: MT7199_1942Help
Entry
MT7199_1942       CDS       T02617                                 

Gene name
aceAb
Definition
putative ISOCITRATE LYASE aceAb [SECOND PART] (ISOCITRASE) (ISOCITRATASE) (ICL) (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mtub01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mtub00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2164301..2166601
Genome map
AA seq 766 aa AA seqDB search
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVA
REAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDP
GPDFASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADADT
GHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFYELGV
KELNGHLLYALGDSEYAAAGGWLERQGIFGLVSDAVNAWREDGQQSIDGIFDQVESRFVA
AWEDDAGLMTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPP
WDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFP
DQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATAL
RQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQH
LVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQ
PIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSK
MKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgaaacggacaccgaggtccacacaccgttcgagcaggactttgagaaa
gacgtagccgccactcagcgatacttcgacagctcgcgctttgctgggatcattcggctc
tacaccgcccgccaagtcgtggaacagcgcggcacgatccccgtcgaccacatcgtggcg
cgagaggcggcgggcgccttctacgagcgtctgcgcgaactctttgcagcccgcaagagc
atcacgacgtttggcccctactcgccggggcaggcggtgagcatgaagcggatgggtatc
gaggcgatctacctcggtggttgggctacctcagctaagggctccagcaccgaagatccg
gggcccgacttcgccagctacccgctgagccaggtgcctgacgatgccgcggtgctggtg
cgcgccttgctcaccgcggaccgcaaccaacactatctacgcctgcagatgagcgagcga
cagcgtgcggcgacaccggcttacgacttccgcccgtttatcatcgccgacgccgacacc
ggccacggcggcgatccgcacgtacgcaacctgatccgccgcttcgtcgaggtcggtgtg
ccgggctaccacatcgaggaccaacgacccggcaccaagaagtgcggccaccagggcggc
aaggtcctggtgccgtccgacgaacagatcaagcggctcaacgccgcccgcttccagctc
gacatcatgcgggtgcccggcatcatcgtcgcacgcaccgacgcggaggcggccaacctg
atcgacagtcgcgccgacgagcgtgaccagccgttccttctcggcgcgaccaagctcgac
gtaccgtcctacaagtcctgtttcctggcaatggtgcggcgtttttacgaactgggcgtc
aaggagctcaatggtcatcttctctatgcgcttggcgacagcgagtacgcggcggccggc
ggttggcttgagcgccaaggcattttcggcttggtctccgacgcggtcaacgcgtggcgg
gaggacggccagcagtcgatcgacggcattttcgaccaggtcgagtcgcggttcgtggcg
gcctgggaggacgacgcgggcctgatgacctacggagaggccgtggcggacgtgctcgaa
ttcggtcagagcgagggcgaacccattggcatggctcccgaggagtggcgggcgttcgcc
gcgcgtgcatcgctgcatgccgcccgggcaaaggccaaggagctgggcgccgatccgcca
tgggactgcgagctggccaagaccccggagggctactaccagatccgcggcggcataccg
tatgcgatcgccaaatcgctggccgcggcaccgtttgccgacattctttggatggagacc
aagaccgccgatctcgccgacgctcgacagttcgccgaggcgatccatgccgagttcccc
gaccagatgctggcgtacaacctctcaccatcgttcaactgggacaccaccggcatgacc
gacgaggagatgcggcgcttccccgaggagctcggcaaaatgggcttcgtcttcaacttc
atcacctatggcgggcaccagatcgacggtgtcgcggccgaggaattcgccaccgcgctg
cgccaggacggcatgctggcgctggctcggttgcagcgcaagatgcgcttggtcgaatct
ccctatcgcacaccgcaaacgctagtcggcgggccgcgcagtgacgccgcattggctgcc
tcctccggacgcacggcgaccacgaaggcaatgggcaagggctccacccagcaccagcac
ttggtgcaaactgaggtgccgcgcaagctgctagaggaatggctggccatgtggagcggt
cactaccagctcaaagacaaactgcgcgtacagcttcggccgcagcgggccggctcggag
gtgctcgagctcggcatccacggcgaaagcgatgacaagctcgccaacgtgatattccaa
ccgatccaagatcgccgcggccgcaccatcctgttggtacgcgaccagaacacgttcggt
gcggaactacgccaaaagcggctgatgaccctgatccacctctggctcgtccaccgcttc
aaggcgcaggcggtgcactacgtcacgcccaccgacgacaacctctaccagacctcgaag
atgaagtcgcatggaatcttcaccgaggtcaaccaggaggtgggcgagatcatcgtcgcc
gaggtgaaccacccgcgcatcgccgaactgctgacgcccgatcgggtggcgctgcggaag
ttgatcacgaaggaggcgtag

DBGET integrated database retrieval system