KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2709Help
Entry
MT7199_2709       CDS       T02617                                 

Definition
putative PROTOPORPHYRINOGEN OXIDASE HEMY (PROTOPORPHYRINOGEN-IX OXIDASE) (PROTOPORPHYRINOGENASE) (PPO) (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtub00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MT7199_2709
Enzymes [BR:mtub01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MT7199_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2991928..2993286)
Genome map
AA seq 452 aa AA seqDB search
MTPRSYCVVGGGISGLTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAE
AFVLRRPEMPALLAELGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLV
DDATLARIDAEAARPFTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGL
RAAAPSVAAALDRGATSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRA
RVVQLERGWVLRDETGGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVA
LAVPGGTAFPHCSGVLVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTAS
DDQLLAWAADDLVTVFGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAG
SYLDGIGVPACVGAAGRAVTSVIEALDAQVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactccccgctcgtattgtgttgtaggaggcgggatttcgggattgacctcggcgtac
cggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttcgaaccggccgatagg
ctcggcggggtattgcgcaccgagcatatcggcggacagccaatggacctcggcgcggag
gcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgagctgggcctgtcggac
cgccaactcgccagcaccggcgcgcggccgctcatctacagccagcagcgcttgcacccg
ctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctccatggcggggctggtc
gacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccgttcacctggcaggtg
ggcagcgatcccgcggtggccgacttggtggctgaccggttcggcgaccaagtcgtggcc
cggtcggtggacccgctgttaagcggggtatacgcgggctcggcggcgacgatcgggctg
cgcgcggccgccccgagcgtggccgcggccctggatcgcggggcgaccagtgtgaccgac
gcggtccggcaggcgctgccgccgggaagcggcgggccggtgttcggcgcgctggacggc
gggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtgcactgggtgcgggcc
agggtggtccagctcgaacgcggctgggtgctgcgcgacgaaaccggcggccgctggcag
gccgacgccgtcatcctggcggttccggcgccgcggttggcgcgcctcgtcgatggcatc
gcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcgtcggcggtggtggcg
ctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtgctggtggccggcgac
gagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatggggtcagcgcggcgac
gtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccggccctgacggcctcc
gacgaccaactcctggcctgggcagcggacgacttggtcacggtgttcggtgtggccgtc
gacccggtcgacgttcgggtccggcgctggatcgaggcgatgccgcagtacggtcccggc
catgccgatgtggtcgccgagctgcgcgccggcctgccaccgacgctggccgttgcgggc
agctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcgggccgggccgtcacc
agcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system