KEGG   Mycobacterium tuberculosis 7199-99: MT7199_3584Help
Entry
MT7199_3584       CDS       T02617                                 

Gene name
ltp3b
Definition
(GenBank) putative LIPID CARRIER protein OR KETO ACYL-COA THIOLASE LTP3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtub00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MT7199_3584 (ltp3b)
   00630 Glyoxylate and dicarboxylate metabolism
    MT7199_3584 (ltp3b)
   00640 Propanoate metabolism
    MT7199_3584 (ltp3b)
   00650 Butanoate metabolism
    MT7199_3584 (ltp3b)
  Lipid metabolism
   00071 Fatty acid degradation
    MT7199_3584 (ltp3b)
   00072 Synthesis and degradation of ketone bodies
    MT7199_3584 (ltp3b)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MT7199_3584 (ltp3b)
   00310 Lysine degradation
    MT7199_3584 (ltp3b)
   00380 Tryptophan metabolism
    MT7199_3584 (ltp3b)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MT7199_3584 (ltp3b)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MT7199_3584 (ltp3b)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MT7199_3584 (ltp3b)
Enzymes [BR:mtub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MT7199_3584 (ltp3b)
Exosome [BR:mtub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MT7199_3584 (ltp3b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
3969279..3969974
Genome map
AA seq 231 aa AA seqDB search
MVAVKDRLNGSRNPLAHLQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEI
ADARLAQGHPVAWIHGTALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAA
EIYVPFSWFEPMWLENLGFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLI
RFAEAAIQVMGKAEARQVPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacatctgcagcag
cccgacatcaccctggagaaggtgatggcatctcagatgctctgggatccaatacgtttc
gatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgacgaggagatc
gccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcaccgcattacgc
accgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggccgcgacgcg
gcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatcgacgccgcc
gaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctgggatttgcc
cgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggcggtcgacta
ccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcgggcctgatc
cgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaagttccgggt
gcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctctatgtgggtg
gtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system