KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_06605Help
Entry
J113_06605        CDS       T02652                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtuc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050659..1051150
Genome map
AA seq 163 aa AA seqDB search
MSWRGVGRDTQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEIL
HVAKISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTG
LPCPVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatggcggggcgttggccgggacacccagccgcgcgcgctcgggcccgatgcgctg
gacgtcagcaccgacgacctggccgggctgttggccggcaacaccggccggatcaagacc
gtcatcaccgaccagaaggtaattgccggcatcggcaacgcctatagtgacgaaatcctg
cacgtcgcgaagatctcgccgttcgccacggccggcaagttatccggcgcacagctcacc
tgcctgcatgaggcgatggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccag
ggcgcggccatgctcaaaggggagaaacgttctgggcttcgagtacatgcgcgcaccggg
ttaccctgcccagtgtgcggtgacaccgtgcgggaggtgtccttcgcggacaagtctttt
cagtactgtccaacgtgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcgg
ctgctcaagtag

DBGET integrated database retrieval system