KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_12390Help
Entry
J113_12390        CDS       T02652                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J113_12390
Enzymes [BR:mtuc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     J113_12390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2010533..2011087)
Genome map
AA seq 184 aa AA seqDB search
MTPDWLGLPDKLAGRRAWGLAVQLYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVN
PLHAATLPGPAGRSKPIEPSPYLPTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQ
QHADQLDTIDRDSAWAAKRAALKLVHRRAAVGGSRAGLRRLPYPRGPRPRRLRHLVRAGR
DVRR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccggattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctg
gccgtccagctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgat
ttggcgaatctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaat
cccctgcatgcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcg
ccctacctgccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccatt
ccggaactcgtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaa
cagcacgccgaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgca
gcactcaagctcgtgcaccggcgtgccgcggtcggcgggtcgcgagctggcctacgccgc
cttccgtacccgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccga
gacgtacggcgatga

DBGET integrated database retrieval system