KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_17185Help
Entry
J113_17185        CDS       T02652                                 

Definition
NAD-dependent glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mtuc00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mtuc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtuc00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:mtuc00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2767999..2770230)
Genome map
AA seq 743 aa AA seqDB search
MLDVTDNVDHATASVNPPPEVVRRDGDDAYLVVAADKGTATFSDIANDVAKSYGFWLGDA
FASGGSVGYDHKAMGITARGAWEAVKRHFREIGIDTQTQDFTVVGIGDMSGDVFGNGMLL
SKHIRLIAAFDHRHIFLDPNPDAAVSWAERRRMFELPRSSWGDYDRSLISEGGGVYSREQ
KAIPLSAQVRAVLGIDGSVDGGAAEMAPPNLIRAILRAPVDLLFNGGIGTYIKAESESDA
DVGDRANDPVRVNANQVRAKVIGEGGNLGVTALGRVEFDLSGGRINTDALDNSAGVDCSD
HEVNIKILIDSLVSAGTVKADERTQLLESMTDEVAQLVLADNEDQNDLMGTSRANAASLL
PVHAMQIKYLVAERGVNRELEALPSEKEIARRSEAGIGLTSPELATLMAHVKLGLKEEVL
ATELPDQDVFASRLPRYFPTALRERFTPEIRSHQLRREIVTTMLINDLVDTAGITYAFRI
AEDVGVTPIDAVRTYVATDAIFGVGHIWRRIRAANLPIALSDRLTLDTRRLIDRAGRWLL
NYRPQPLAVGAEINRFAAMVKALTPRMSEWLRGDDKAIVEKTAAEFASQGVPEDLAYRVS
TGLYRYSLLDIIDIVDIADIDAAEVADTYFALMDRLGTDGLLTAVSQLPRHDRWHSLARL
AIRDDIYGALRSLCFDVLAVGEPGESSEQKIAEWEHLSASRVARARRTLDDIRASGQKDL
ATLSVAARQIRRMTRTSGRGISG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgatgtcaccgacaacgtcgatcatgcgaccgcaagcgtcaaccccccgcccgag
gtggtgcgacgtgacggcgacgacgcctacttggtagtggccgccgacaaaggtactgcc
accttttccgatatcgccaacgatgtcgccaagtcctatgggttctggctgggcgacgcg
ttcgcctcgggcggatcggtgggctacgaccacaaggccatgggcatcaccgcccggggg
gcctgggaggccgtaaaacggcatttccgagagatcgggatcgacacccagacccaggat
ttcaccgtcgtgggaatcggcgacatgagcggcgacgtattcggcaacggcatgttgctg
agcaagcacatccggctgatcgccgccttcgaccaccgccacatcttcctcgaccccaac
cccgatgccgcggtgtcgtgggccgaacgccggcggatgttcgagttgccccggtccagc
tggggcgactatgacaggtctctgatcagcgagggcggcggggtgtacagccgcgaacag
aaagccatcccgctcagcgcgcaggtccgcgccgtcctcggcatcgacggctcagttgac
gggggggccgccgagatggccccgcccaaccttattcgggcgattctgcgggcgccggtg
gacctgctgttcaacggcggcatcggcacttacatcaaggccgagtcagagtcggatgct
gatgtcggcgatcgcgccaacgatccggtgcgagtcaacgcgaatcaagtgcgcgccaag
gtcattggcgaaggtggcaatctcggagtgacggcgttgggccgtgtcgaattcgatctg
tccggcggccggatcaacaccgacgcgctggacaactccgccggcgtggactgctcggac
cacgaggtcaacatcaagatcctgatcgactcgctggtgagcgccggcacggtcaaagcc
gacgaacgcacacagctgctcgagtcaatgaccgacgaggtagcgcaactggtgctcgcc
gacaacgaagatcagaacgacttgatgggcaccagtcgcgccaacgcggccagcctgctg
ccggtgcacgcaatgcagatcaagtatttggtggctgagcgcggggtcaaccgcgaattg
gaagcgctgccgtcggagaaggagattgcccggcgctccgaggccggcatcgggctcacc
tcgcccgaactcgccacgctgatggcgcacgtcaagctggggctcaaagaggaggtgcta
gccaccgaactaccggatcaggatgtcttcgcttccaggttgcctcgttatttcccgacg
gcgctgcgcgaacggttcaccccggagatccgttcccaccagctgcgccgcgagatcgtc
accaccatgctgatcaacgatctggtggataccgccggcatcacctatgcgttccggatc
gccgaagacgttggtgtcacgccgatcgatgccgtgcgcacctatgtcgccaccgatgcc
atcttcggtgtcggtcacatttggcgccggatccgtgcggcgaacctgccaatcgcgctg
tcagacaggttgacgctggacacccgtcggctgatcgaccgtgccggacgctggctgctc
aactaccgtccgcagcccttggccgtcggcgccgagatcaaccgattcgcggccatggtc
aaggcactgacaccgcgcatgtcggagtggttgcgtggtgatgacaaggccatcgtcgaa
aagacagctgcggaattcgcatcgcagggtgtgcctgaagacttggcctaccgtgtctcg
accggcctgtaccggtacagcctgctcgacatcatcgacatcgtcgacatcgccgacatc
gacgccgccgaggtcgctgacacctatttcgccctgatggaccggctgggcaccgatggc
ctgctgaccgcggtatcccagctgccccgacacgaccgctggcattcgttggcgcgcttg
gcgattcgcgacgatatttacggtgcgctacggtcgttgtgtttcgacgtgctggccgtg
ggggaacccggcgagagtagcgagcaaaagatcgccgagtgggaacacctcagcgcctcc
cgggtggcgcgggcacgtcggacactcgacgacatccgtgccagcggccagaaggatctg
gcgacgttgtcggtcgccgcgcggcagatccgccgcatgacacggacaagcgggcgagga
atctcggggtga

DBGET integrated database retrieval system