KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_18625Help
Entry
J113_18625        CDS       T02652                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    J113_18625
Enzymes [BR:mtuc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     J113_18625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2982891..2983637)
Genome map
AA seq 248 aa AA seqDB search
MFEPADRLGGVLRTEHIGGQPMDLGAEAFVLRRPEMPALLAELGLSDRQLASTGARPLIY
SQQRLHPLPPQTVVGIPSSAGSMAGLVDDATLARIDAEAARPFTWQVGSDPAVADLVADR
FGDQVVARSVDPLLSGVYAGSAATIGLRAAAPSVAAALDRGATSVTDAVRQALPPGSGGR
CSARSTSSRMPGRAVRRSRTGLCGGSRAGWVLRDETGGRWQADAVILAVPAPRLARLVDG
IAPATGPL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaccggccgataggctcggcggggtattgcgcaccgagcatatcggcggacag
ccaatggacctcggcgcggaggcgttcgtgctgcgtaggcccgagatgccggcgcttttg
gccgagctgggcctgtcggaccgccaactcgccagcaccggcgcgcggccgctcatctac
agccagcagcgcttgcacccgctgccgccgcagacggtcgtcgggatcccgtcgtcggcg
ggctccatggcggggctggtcgacgacgcaaccctggcgcggatcgacgccgaagccgct
cgtccgttcacctggcaggtgggcagcgatcccgcggtggccgacttggtggctgaccgg
ttcggcgaccaagtcgtggcccggtcggtggacccgctgttaagcggggtatacgcgggc
tcggcggcgacgatcgggctgcgcgcggccgccccgagcgtggccgcggccctggatcgc
ggggcgaccagtgtgaccgacgcggtccggcaggcgctgccgccgggaagcggcgggcgg
tgttcggcgcgctcgaccagttccaggatgcctggacgggctgtccggcgcagccggacc
gggctttgcggcggtagtcgcgccggctgggtgctgcgcgacgaaaccggcggccgctgg
caggccgacgccgtcatcctggcggttccggcgccgcggttggcgcgcctcgtcgatggc
atcgcgccggccaccggcccgctgtga

DBGET integrated database retrieval system