KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_22075Help
Entry
J113_22075        CDS       T02652                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00260  Glycine, serine and threonine metabolism
mtuc00330  Arginine and proline metabolism
mtuc00340  Histidine metabolism
mtuc00350  Tyrosine metabolism
mtuc00360  Phenylalanine metabolism
mtuc00380  Tryptophan metabolism
mtuc01100  Metabolic pathways
mtuc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    J113_22075
   00330 Arginine and proline metabolism
    J113_22075
   00340 Histidine metabolism
    J113_22075
   00350 Tyrosine metabolism
    J113_22075
   00360 Phenylalanine metabolism
    J113_22075
   00380 Tryptophan metabolism
    J113_22075
Enzymes [BR:mtuc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     J113_22075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AGL28619
UniProt: R4MA87
Position
3527524..3528063
Genome map
AA seq 179 aa AA seqDB search
MAIEFDPPLPPEYQQLAHHWPQGRLSKAYAAYSTPFWRASGYSGQALSDEAPVFITFDVS
PHADGPGILMGFVDARGFDSLPIEERRRDALRCFASLFGDEALDPLDYVDYRWGTEEFAP
GGPTAAVPPGSWTKYGHWLREPVGPIHWASTETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcgagttcgatcccccgctgccgccggaatatcaacagctcgcccaccattgg
ccgcagggccggctgagcaaggcctacgcggcctattcgacgccgttctggcgggccagc
gggtattccggccaggcgctgtccgatgaggcgccggtgttcatcaccttcgacgtcagt
ccgcacgccgacgggccaggcattctgatggggttcgtcgatgctcgcgggttcgactcg
ctacccatcgaagagcgccgccgcgatgcattgcgctgctttgcgtcgctgttcggcgac
gaagcgctcgacccccttgattatgttgactatcgttggggtacagaggaattcgcgccg
ggtggtccgaccgcggcggtaccgccggggtcgtggacgaaatacggtcactggttacgt
gagccggtcggtccgattcactgggcgagcactgagaccgcggacgaatggaccgggtat
ttcgacggcgccgtcagatccggtcagcgtgccgccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system