KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_22075Help
Entry
J113_22075        CDS       T02652                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    J113_22075
   00330 Arginine and proline metabolism
    J113_22075
   00340 Histidine metabolism
    J113_22075
   00350 Tyrosine metabolism
    J113_22075
   00360 Phenylalanine metabolism
    J113_22075
   00380 Tryptophan metabolism
    J113_22075
Enzymes [BR:mtuc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     J113_22075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3527524..3528063
Genome map
AA seq 179 aa AA seqDB search
MAIEFDPPLPPEYQQLAHHWPQGRLSKAYAAYSTPFWRASGYSGQALSDEAPVFITFDVS
PHADGPGILMGFVDARGFDSLPIEERRRDALRCFASLFGDEALDPLDYVDYRWGTEEFAP
GGPTAAVPPGSWTKYGHWLREPVGPIHWASTETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcgagttcgatcccccgctgccgccggaatatcaacagctcgcccaccattgg
ccgcagggccggctgagcaaggcctacgcggcctattcgacgccgttctggcgggccagc
gggtattccggccaggcgctgtccgatgaggcgccggtgttcatcaccttcgacgtcagt
ccgcacgccgacgggccaggcattctgatggggttcgtcgatgctcgcgggttcgactcg
ctacccatcgaagagcgccgccgcgatgcattgcgctgctttgcgtcgctgttcggcgac
gaagcgctcgacccccttgattatgttgactatcgttggggtacagaggaattcgcgccg
ggtggtccgaccgcggcggtaccgccggggtcgtggacgaaatacggtcactggttacgt
gagccggtcggtccgattcactgggcgagcactgagaccgcggacgaatggaccgggtat
ttcgacggcgccgtcagatccggtcagcgtgccgccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system