KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_23155Help
Entry
J113_23155        CDS       T02652                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mtuc00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3688489..3689202)
Genome map
AA seq 237 aa AA seqDB search
MIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRRGDVP
LGRTVGMLEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRDGTAMDRF
RRLVAAQGGDLSKPLPMSTVTGAGASGTMGDIDAMAVGLAAWRLGAGRSRPGARVQHGAG
VRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRPLIVDRIV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgccagttcgattatgagcaagaagctggctgagggtgcgggtgcactggtgctc
gacgtcaaggttggttccggggccttcatgaggtcgccagtgcaggcgcgcgaacttgcg
cacaccatggtcgaactgggcgcggcgcatggcgtgcccacccgccgaggtgatgtgccc
ctgggtcgaaccgtcggcatgctcgaggtggccgaggcgctggaagtgctggccggcggc
ggaccgcccgacgtggtggagctgacgttgcggctggccggcgagatgctcgagcttgcc
gggatccacggccgggacccggcccagacgctgcgggacggcaccgcaatggaccggttt
cgccggttggttgccgcgcagggaggtgacttgtcgaaaccgttgccgatgtccacggta
accggggcgggcgcgagcggcacaatgggcgacatcgatgcgatggcagtggggttagcg
gcatggcgactcggtgcgggcaggtcccgcccgggcgcacgcgtacagcacggtgcgggg
gtgcggattcatcgccgcccgggggagccggttgtggtcggtgagccgttgttcaccctc
tacacgaatgctcccgagcgctttggtgcggcgcgagccgagctggccggcggttggagt
atccgggacagtccgccgcaggtgcggccgctaatcgtcgatcggatcgtctga

DBGET integrated database retrieval system