KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_24725Help
Entry
J113_24725        CDS       T02652                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00360  Phenylalanine metabolism
mtuc00362  Benzoate degradation
mtuc00620  Pyruvate metabolism
mtuc00621  Dioxin degradation
mtuc00622  Xylene degradation
mtuc00650  Butanoate metabolism
mtuc01100  Metabolic pathways
mtuc01120  Microbial metabolism in diverse environments
mtuc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    J113_24725
   00650 Butanoate metabolism
    J113_24725
  Amino acid metabolism
   00360 Phenylalanine metabolism
    J113_24725
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J113_24725
   00622 Xylene degradation
    J113_24725
   00621 Dioxin degradation
    J113_24725
Enzymes [BR:mtuc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     J113_24725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer
Motif
Other DBs
NCBI-ProteinID: AGL29011
UniProt: R4MM36
Structure
PDB: 

Jmol
Position
complement(3956223..3956762)
Genome map
AA seq 179 aa AA seqDB search
MITCGGQATIPIVYAVSRIVEAYAEIVASVASVSAGPGTRANIDEFTKTTARGVQTIGGA
ARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLLNEPQ
FDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVGGAR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtctcggatcgtg
gaggcctacgccgagatcgtggcgtcggtggcttccgtttcagcgggaccgggcacgcgc
gccaacatcgacgagttcaccaagaccaccgcccgtggggtccagaccatcggcggggcc
gcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatgatcatgcgcgac
accatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgccgcctccatccac
gacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctcaacgaaccgcag
ttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacgttcgtcgaggtt
gagggcgccggggattacctgccgccctatgcgggcaacctggacatcatgaccgcggcg
gccaccaaggtgggcgaggagatcgccaaggagacgctggttgtaggaggagcgcgatga

DBGET integrated database retrieval system