KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_03875Help
Entry
J114_03875        CDS       T02653                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtue00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(819697..820353)
Genome map
AA seq 218 aa AA seqDB search
MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLV
DAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEF
AIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVE
RTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgttgacgccccggaatccgcggtgctggcggccgccaaggacatgttgcgt
cggggcctggtcgaggggaccgccggaaatatctcagccaggcgctcggacggcaacgtg
gtcatcacgccgtcctcggtcgactacgccgagatgctgctccacgatctggtgctagtc
gacgccggcggtgcggtgctgcacgccaaggacggccggtcgccgtcgaccgaactaaac
ctacacctggcgtgctatcgcgcattcgacgacattggcagcgtgatccacagccacccg
gtgtgggcgaccatgttcgccgtcgcccatgagccgattcccgcctgcatcgacgagttc
gcgatctactgcggcggggacgttcgctgcaccgagtacgccgcgtccggtacacccgag
gtcggccgcaacgcggtgcgcgcgcttgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggccgtggggccccgccccgaccaggtgctgcgcgtcaccgcccttgttgag
cgcaccgcacaaatcgtttggggtgcccgcgctctcggtggaccggtgccaattcctgag
gacgtgtgccgtaacttcacgggcgtctacggctatctgcgcgcgaatccgctctag

DBGET integrated database retrieval system