KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_05055Help
Entry
J114_05055        CDS       T02653                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtue03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052221..1052697
Genome map
AA seq 158 aa AA seqDB search
MAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKI
SPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPV
CGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggccgggacgccgcagccgcgcgcgctcgggcccgatgcgctggacgtcagcaccgac
gacctggccgggctgttggccggcaacaccggccggatcaagaccgtcatcaccgaccag
aaggtaattgccggcatcggcaacgcctatagtgacgaaatcctgcacgtcgcgaagatc
tcgccgttcgccacggccggcaagttatccggcgcacagctcacctgcctgcatgaggcg
atggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccagggcgcggccatgctc
aaaggggagaaacgttctgggcttcgagtacatgcgcgcaccgggttaccctgcccagtg
tgcggtgacaccgtgcgggaggtgtccttcgcggacaagtcttttcagtactgtccaacg
tgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcggctgctcaagtag

DBGET integrated database retrieval system