KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_06655Help
Entry
I917_06655        CDS       T02654                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtuh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056117..1056620
Genome map
AA seq 167 aa AA seqDB search
MLVAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVA
KISPFATAGKLSGAQLXCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPC
PVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLKXSICSPE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtggccgggacgccgcagccgcgcgcgctcgggcccgatgcgctggacgtcagc
accgacgacctggccgggctgttggccggcaacaccggccggatcaagaccgtcatcacc
gaccagaaggtaattgccggcatcggcaacgcctatagtgacgaaatcctgcacgtcgcg
aagatctcgccgttcgccacggccggcaagttatccggcgcacagctcmcctgcctgcat
gaggcgatggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccagggcgcggcc
atgctcaaaggggagaaacgttctgggcttcgagtacatgcgcgcaccgggttaccctgc
ccagtgtgcggtgacaccgtgcgggaggtgtccttcgcggacaagtcttttcagtactgt
ccaacgtgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcggctgctcaag
kagtcgatatgctcaccggagtga

DBGET integrated database retrieval system