KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_08050Help
Entry
I917_08050        CDS       T02654                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I917_08050
   00630 Glyoxylate and dicarboxylate metabolism
    I917_08050
   00640 Propanoate metabolism
    I917_08050
   00650 Butanoate metabolism
    I917_08050
  Lipid metabolism
   00071 Fatty acid degradation
    I917_08050
   00072 Synthesis and degradation of ketone bodies
    I917_08050
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I917_08050
   00310 Lysine degradation
    I917_08050
   00380 Tryptophan metabolism
    I917_08050
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I917_08050
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I917_08050
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I917_08050
Enzymes [BR:mtuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I917_08050
Exosome [BR:mtuh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I917_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1267172..1267414
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGXANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggcmaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system