KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_12655Help
Entry
I917_12655        CDS       T02654                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I917_12655
Enzymes [BR:mtuh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     I917_12655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2016972..2018789)
Genome map
AA seq 605 aa AA seqDB search
MTDAGSGEXXXXXPXXXPLGYHRVNLRSGDSQASAAVVVTPDWLGLPDKLAGRRAWGLAV
QLYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPSPY
LPTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRAAL
KLVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAETYGDDWHRWPKSLRHPDASGVA
DFVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLGIMADLAVGVHPNGADAWALQD
VLAQGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEQEYRPFRALIQAALRHAGAVRIDHII
GLFRLWWIPDGAPPTQGTYVRYDHDAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLL
RGLLGTSILWFEQDRDCGPAGTPLPAERWREYCLSSVTTHDLPPTAGYLAGDQVRLRESL
GLLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDSEEAVLALYRYLGRTPSRLLAV
ALTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPXXLEDIFTDRRAATLAEAVRAATTS
PMSCW
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
ttgacggacgctggatcgggcgagsccrscttsktkttscccsccgmccygcccctcggc
taccaccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtcgtgacg
ccggattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctggccgtc
cagctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgatttggcg
aatctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaatcccctg
catgcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcgccstac
ctgccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccattccggaa
ctcgtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaacagcac
gccgaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgcagcactc
aagctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgccttccgt
acccgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgagacgtac
ggcgatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggtgtcgcc
gatttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtggcagctg
gacgagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctgggcatc
atggcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctgcaggac
gtgctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactcggccag
gactggtcgcagccaccgtggcggccggaccggctcgctgagcaggagtaccgaccgttt
cgcgcgctgatccaggccgcgttgcggcacgccggtgcggtacgcatcgaccacatcatc
gggctgttccggttgtggtggatccccgacggcgcaccgcccacccaaggcacctatgtg
cgctacgaccacgacgcgatgatcggcatcgtcgccctggaagcccaccgggccggggcg
gttgtcgtcggtgaggatctcggcaccgtcgagccgtgggtacgcgactatctactattg
cggggcctgctgggcacctcaattctctggtttgagcaggatcgagattgcgggccggct
ggaacaccattgccggccgaacgctggcgggagtactgcttgtcgtcggtgaccacccat
gatctgccgccgaccgccggctacctggccggcgaccaggtacggctgcgcgagtccctt
gggttgttaaccaaccccgtggaggcggaactcgaatccgcccgggccgaccgggcagcc
tggatggccgagctgcgccgggtcggactgctggcggacggtgccgagcccgactcggag
gaggccgtcctggctctctaccgctacctgggccgaacgccctcgcggctgttggcagtg
gcgttgaccgatgcggtcggcgaccgccggacgcaaaaccagcctggcaccaccgacgag
tacccgaactggcgggtgccgctcaccggccccgacggkcagccgrtgstgctcgaggac
atcttcaccgatcgcagggcagccaccttggccgaggcggtgcgcgctgcgacgacctca
ccgatgagctgttggtga

DBGET integrated database retrieval system