KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_17180Help
Entry
I917_17180        CDS       T02654                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    I917_17180
Enzymes [BR:mtuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     I917_17180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2731010..2731993
Genome map
AA seq 327 aa AA seqDB search
MAPRVCVVGSVNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAAARAGAQVQFSG
AFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLVAPGANAHLTPV
PSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSLQDLAAIADVVI
ANEHEANDWPSPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGAGDVFAGVLAAN
WPRNPGSPAERLRALRRACAAGALATLVSGVGDCAPAAAAIDAALRANRHNGSXPXLRXE
GDPLMRTTTAADLALALFAVFSVVGFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgggtgtgcgtggtaggcagcgtgaacatggacctgacgttcgtggtggac
gcgcttccgcgccccggcgagacggtgcttgcggcgtcgttgacccgaacgccaggcggg
aagggcgccaaccaggcggtggccgcagcgcgcgcaggcgcgcaggtacagttctccggt
gcattcggcgacgatccagccgccgcccagctgcgggcccacctgcgcgccaacgccgtt
ggactggacaggaccgtcacggtgcccggaccgagcgggacggcgattatcgtggtcgat
gccagcgccgagaacaccgtgctggtggcgccgggtgccaatgcacatctgactccggta
ccctcggccgtcgccaactgcgatgtactgttgacccagttggagattcctgttgcaacc
gcgctggcagccgcgcgggcagcccagtcggccgatgcggttgtcatggtcaacgcctcc
ccagccggccaggatcgaagctccttgcaggacttggccgctatcgccgacgtggtgatc
gccaacgagcatgaggcaaacgactggccgtcgccaccaacacatttcgtgatcaccctg
ggtgtgcgcggtgcccggtacgtcggcgcggacggggtkttcgaggtmcccgccccaacg
gtaacgccagtggataccgccggcgccggcgacgtatttgccggggtccttgctgcgaat
tggccgcgcaacccaggttcgccggccgagcgactgcgcgcattgcggcgggcctgcgct
gcgggtgcgctggcaactttggtgtccggtgtcggcgactgcgcaccggccgccgccgcg
atcgatgcggccctgcgagccaaccgccacaacggttcatgmccackgctmcgcrccgaa
ggagacccgctgatgcgaacgaccaccgcggccgacttagcgctggcactcttcgcggtt
ttcagtgtggtcggattcggctga

DBGET integrated database retrieval system