KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_17210Help
Entry
I917_17210        CDS       T02654                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00330  Arginine and proline metabolism
mtuh00332  Carbapenem biosynthesis
mtuh01100  Metabolic pathways
mtuh01130  Biosynthesis of antibiotics
mtuh01230  Biosynthesis of amino acids
Module
mtuh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    I917_17210
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    I917_17210
Enzymes [BR:mtuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     I917_17210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGL24048
UniProt: R4M4F4
Position
complement(2734781..2736010)
Genome map
AA seq 409 aa AA seqDB search
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVDAMVFA
GAIAAASPRAVPSSQRSGDQAGGGQRRAGRAGELVERGVRPLRPHGGPXXADRAXHFBAG
AAHQRPYARWIGXARCTRVAIVNEXDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDI
DGLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVAAALLAADAGVPVL
LAPAADAATALADASVGTVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRS
LLAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASVAGXXXWAXPPLSYPASCAAR
WCTPTIWSRCRRSKLSKFSYHIAPRCGVPQMISINMXASCALRPSGYPR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtccgcatcgggacgcaatccggaccgcgcgcggccttgtcgtgaaggtcggg
accacggcgcttaccacaccgtccgggatgttcgatgccggccggctggccggactggcc
gaggcggtcgagcggcggatgaaggcgggttccgacgttgtcgatgcgatggtcttcgcg
ggcgccatcgccgcggccagcccccgggctgtcccgtcgtcccaaagatctggcgaccaa
gcaggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagcgcggcgttcgc
ccgctacggccgcacggtgggccasgtrctgctgaccgcgcaygacatttcratgcgggt
gcagcacaccaacgcccatacgcacgctggatcggctgsgcgcgytgcacgcgggtggcg
attgtcaacgagaamgacaccgtggccaccaacgagatccggttcggtgacaacgatcgg
ctrtctgcrctggtggcgcacctggtcggcgccgacgctttggtgctgctgtcggacatc
gacggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcattccggaggtg
tccgggccggcggatctggacggtgtggtcgccggccgcagtagccacctgggtactggc
ggcatggcgtccaaggtggcggcggcgctgttggccgccgacgccggggtgccggtactg
ctggcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggcacggtgttt
gcggcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgccgccgaagca
accggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaacgccggtca
ctgctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgatgtggtcgaa
ctgcgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgacgcgtccgtw
gctggcywcsgatgstgggccrgtccacctctgagctacccggcgagctgcgccgccmgg
tggtgcacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtttagctac
catattgctccgagatgcggtgtaccccaaatgatttcgatcaacatgsccgctagctgc
gcattgcggccgagcgggtatccgaggtga

DBGET integrated database retrieval system