KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_22280Help
Entry
I917_22280        CDS       T02654                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtuh00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtuh00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mtuh00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mtuh00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mtuh00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mtuh00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3535311..3536657
Genome map
AA seq 448 aa AA seqDB search
MTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGVPADMGG
SFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLIDIGRLR
WQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTWGCEPDD
VSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNAAVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRLSKAYAA
YSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGXDXLPIEERRRDAL
RCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGPIHWAST
ETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccaccgtggactgtcgatgttgtcgtggtgggcgcgggcttcgccgggctg
gccgcggcccgcgagctgacgcgacagggtcacgaggtgctggtgttcgaaggccgcgat
cgggtgggcggccgctcgttaaccggtcgcgtggcaggggtgcccgcggatatgggcggc
tcgttcatcggcccgacccaagacgccgtgctggcgttggccaccgagctggggatcccg
acaaccccgacccaccgcgacggccgaaacgtcatccagtggcggggatcggcacgcagc
tatcgtggcaccatccccaagctgtcgctgaccgggctcatcgacatcggccggttgcgt
tggcaattcgagcgaattgcccgcggcgttccggtggccgccccctgggatgcgcggcgc
gcgcgtgaactcgacgacgtgtcgctcggggagtggttgcgcttggtgcgcgccacatcg
tcctcgcggaacctgatggccatcatgacccgggtgacctggggttgtgagcccgacgat
gtctcgatgctgcacgccgcccgctacgtacgcgcggccggcggcctggaccggctgctc
gacgtcaaaaatggtgcccagcaggaccgtgtgccgggggggacacagcagatcgcccag
gcggccgccgcccaactcggcgcacgcgtcctgctcaacgccgcggtgcgtcgcatcgac
cggcacggagcgggtgtgacggtcacgtccgatcagggtcaggccgaggccgggttcgtc
atcgtcgccattccaccggcccatcgcgtggccatcgagttcgatcccccgctgccgccg
gaatatcagcagctcgcccaccattggccgcagggccggctgagcaaggcctacgcggcc
tattcgacgccgttctggcgggccagcgggtattccggccaggcgctgtccgatgaggcg
ccggtgttcatcaccttcgacgtcagtccgcacgccgacgggccaggcattctgatgggg
ttcgtcgatgctcgcgggktcgactygctacccatcgaagagcgccgccgcgatgcattg
cgctgctttgcgtcgctgttcggcgacgaagcgctcgacccccttgattatgttgactat
cgttggggtacagaggaattcgcgccgggtggtccgaccgcggcggtaccgccggggtcg
tggacgaaatacggtcactggttacgtgagccggtcggtccgattcactgggcgagcact
gagaccgcggacgaatggaccgggtatttcgacggcgccgtcagatccggtcagcgtgcc
gccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system