KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_22280Help
Entry
I917_22280        CDS       T02654                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I917_22280
   00330 Arginine and proline metabolism
    I917_22280
   00340 Histidine metabolism
    I917_22280
   00350 Tyrosine metabolism
    I917_22280
   00360 Phenylalanine metabolism
    I917_22280
   00380 Tryptophan metabolism
    I917_22280
Enzymes [BR:mtuh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     I917_22280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3535311..3536657
Genome map
AA seq 448 aa AA seqDB search
MTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGVPADMGG
SFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLIDIGRLR
WQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTWGCEPDD
VSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNAAVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRLSKAYAA
YSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGXDXLPIEERRRDAL
RCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGPIHWAST
ETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccaccgtggactgtcgatgttgtcgtggtgggcgcgggcttcgccgggctg
gccgcggcccgcgagctgacgcgacagggtcacgaggtgctggtgttcgaaggccgcgat
cgggtgggcggccgctcgttaaccggtcgcgtggcaggggtgcccgcggatatgggcggc
tcgttcatcggcccgacccaagacgccgtgctggcgttggccaccgagctggggatcccg
acaaccccgacccaccgcgacggccgaaacgtcatccagtggcggggatcggcacgcagc
tatcgtggcaccatccccaagctgtcgctgaccgggctcatcgacatcggccggttgcgt
tggcaattcgagcgaattgcccgcggcgttccggtggccgccccctgggatgcgcggcgc
gcgcgtgaactcgacgacgtgtcgctcggggagtggttgcgcttggtgcgcgccacatcg
tcctcgcggaacctgatggccatcatgacccgggtgacctggggttgtgagcccgacgat
gtctcgatgctgcacgccgcccgctacgtacgcgcggccggcggcctggaccggctgctc
gacgtcaaaaatggtgcccagcaggaccgtgtgccgggggggacacagcagatcgcccag
gcggccgccgcccaactcggcgcacgcgtcctgctcaacgccgcggtgcgtcgcatcgac
cggcacggagcgggtgtgacggtcacgtccgatcagggtcaggccgaggccgggttcgtc
atcgtcgccattccaccggcccatcgcgtggccatcgagttcgatcccccgctgccgccg
gaatatcagcagctcgcccaccattggccgcagggccggctgagcaaggcctacgcggcc
tattcgacgccgttctggcgggccagcgggtattccggccaggcgctgtccgatgaggcg
ccggtgttcatcaccttcgacgtcagtccgcacgccgacgggccaggcattctgatgggg
ttcgtcgatgctcgcgggktcgactygctacccatcgaagagcgccgccgcgatgcattg
cgctgctttgcgtcgctgttcggcgacgaagcgctcgacccccttgattatgttgactat
cgttggggtacagaggaattcgcgccgggtggtccgaccgcggcggtaccgccggggtcg
tggacgaaatacggtcactggttacgtgagccggtcggtccgattcactgggcgagcact
gagaccgcggacgaatggaccgggtatttcgacggcgccgtcagatccggtcagcgtgcc
gccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system