KEGG   Mycobacterium tuberculosis Haarlem: TBHG_00332Help
Entry
TBHG_00332        CDS       T02845                                 

Definition
aspartate aminotransferase AspC
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtul00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    TBHG_00332
   01230 Biosynthesis of amino acids
    TBHG_00332
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TBHG_00332
   00290 Valine, leucine and isoleucine biosynthesis
    TBHG_00332
Enzymes [BR:mtul01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TBHG_00332
    2.6.1.66  valine---pyruvate transaminase
     TBHG_00332
Amino acid related enzymes [BR:mtul01007]
 Aminotransferase (transaminase)
  Class I
   TBHG_00332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(405033..406322)
Genome map
AA seq 429 aa AA seqDB search
MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRAVVTRYELVPGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQ
PDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGIGLLANMR
LCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgatggcaccattgtggacgtgacaacccaccagctgccctggcacaccgcc
agccatcagcggcagcgcgccttcgctcagtcggccaagctgcaggacgtcctgtacgag
atccgcggcccggtgcaccagcacgccgcgcggctcgaagccgaaggtcaccgcatcctc
aaactcaacatcggcaacccggcgccgttcggcttcgaagcacccgacgtgatcatgcgc
gatatcatccaggcgctgccctacgcgcaggggtactccgactcgcagggcatcctgtcg
gcccggcgtgcggtggtcacgcgctacgagctggtgcccggatttccccgattcgacgtg
gacgacgtctacctgggtaacggggtctccgagctgatcacgatgacgctgcaagccctg
ctggacaacggcgatcaggtgctgattccatcaccggactacccgctgtggacggcgtcg
acctcgctggctggcggcactccggtccactacctgtgcgatgagacccaaggctggcag
cccgatatcgccgacctggaatccaagatcaccgagcgcaccaaggcgctggtcgtgatc
aaccccaacaacccaaccggcgcggtgtacagctgcgaaatcctcacccagatggtcgat
ctggcccgcaagcatcaactgctgctgttggcggacgaaatctacgacaaaatcctctac
gacgacgccaagcacatcagcctggcatcgatcgccccggatatgttgtgcctgaccttc
aatgggctgtcgaaggcctaccgcgtcgccggataccgggccggctggctggcgatcacc
ggacccaaggagcacgccagcagcttcatcgagggcatcggcctgctggccaatatgcgg
ttgtgcccaaatgtcccggcccagcatgccattcaggttgcactgggcggccatcagagc
atcgaggacctggtgctgcccggcggccggctgctcgagcagcgcgacatcgcctggacc
aagctcaacgagatcccgggggtgtcgtgcgtcaaaccggcgggcgcgctgtatgcgttt
ccccggctagaccccgaggtctacgacatcgacgacgacgagcaactcgtgctcgatctg
ctgctgtcggagaagatcctggtcacccagggcaccgggttcaactggcccgcaccggat
catctgcgcctggtgacgctgccatggtcccgcgatctggcggccgccatcgagcggctg
ggtaacttcctggtcagttaccggcaatag

DBGET integrated database retrieval system