KEGG   Mycobacterium tuberculosis Haarlem: TBHG_02961Help
Entry
TBHG_02961        CDS       T02845                                 

Definition
alpha-1,4-glucosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mtul00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TBHG_02961
Enzymes [BR:mtul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TBHG_02961
Glycosyltransferases [BR:mtul01003]
 Polysaccharide
  Storage polysaccharide
   TBHG_02961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3385193..3386437
Genome map
AA seq 414 aa AA seqDB search
MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEG
VRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND
EITELFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPR
LRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPA
AAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctcatggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgc
cacgtgcatcatctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcc
cggtgtccgtcgggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggg
gtccgggtgattgcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatg
gcctggaccctggcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaactt
ggcaccgaccgctcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccat
ccggccatcgcccttgcccagttctatgacgtgccaatggtttccacgattcatgcaacg
gaggccggtcgacattccggctgggtctccggagctctcagccgtcaggtgcacgcggtc
gagtcgtggctggtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgac
gagatcaccgagctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcatt
gacgcggcgcgctggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctc
tatgtggggcggctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcgg
ctcaggcgcactcacccaggcaccacactgaccatcgccggcgaaggcacccagcaggat
tggttgatcgatcaggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacac
ctcgaccacaccgagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagc
cactacgaaccgtttgggctggtggcactggaggccgccgcggccggcaccccgctggtg
acgtccaacatcggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgt
gcaccccgcgacgtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggcc
gccgcgcagcggcgcgcacgagccgcccggcaacggctcacctccgacttcgactggcag
acggtggccaccgcgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccg
cagccccggttgcccatcgtcgagcacgctcttcccgatcggtag

DBGET integrated database retrieval system