KEGG   Mycobacterium tuberculosis Haarlem: TBHG_03102Help
Entry
TBHG_03102        CDS       T02845                                 

Definition
flavin-containing monoamine oxidase AofH
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtul00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtul00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mtul00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mtul00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mtul00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mtul00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3534042..3535406
Genome map
AA seq 454 aa AA seqDB search
MRLTRAVTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGV
PADMGGSFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLI
DIGRLRWQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTW
GCEPDDVSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNA
AVRRIDRHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRL
SKAYAAYSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGFDSLPIEE
RRRDALRCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGP
IHWASTETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgactagagcggtgacaaacccaccgtggactgtcgatgttgtcgtggtgggc
gcgggcttcgccgggctggccgcggcccgcgagctgacgcgacagggtcacgaggtgctg
gtgttcgaaggccgcgatcgggtgggcggccgctcgttaaccggtcgcgtggcaggggtg
cccgcggatatgggcggctcgttcatcggcccgacccaagacgccgtgctggcgttggcc
accgagctggggatcccgacaaccccgacccaccgcgacggccgaaacgtcatccagtgg
cggggatcggcacgcagctatcgtggcaccatccccaagctgtcgctgaccgggctcatc
gacatcggccggttgcgttggcaattcgagcgaattgcccgcggcgttccggtggccgcc
ccctgggatgcgcggcgcgcgcgtgaactcgacgacgtgtcgctcggggagtggttgcgc
ttggtgcgcgccacatcgtcctcgcggaacctgatggccatcatgacccgggtgacctgg
ggttgtgagcccgacgatgtctcgatgctgcacgccgcccgctacgtacgcgcggccggc
ggcctggaccggctgctcgacgtcaaaaatggtgcccagcaggaccgtgtgccggggggg
acacagcagatcgcccaggcggccgccgcccaactcggcgcacgcgtcctgctcaacgcc
gcggtgcgtcgcatcgaccggcacggagcgggtgtgacggtcacgtccgatcagggtcag
gccgaggccgggttcgtcatcgtcgccattccaccggcccatcgcgtggccatcgagttc
gatcccccgctgccgccggaatatcagcagctcgcccaccattggccgcagggccggctg
agcaaggcctacgcggcctattcgacgccgttctggcgggccagcgggtattccggccag
gcgctgtccgatgaggcgccggtgttcatcaccttcgacgtcagtccgcacgccgacggg
ccaggcattctgatggggttcgtcgatgctcgcgggttcgactcgctacccatcgaagag
cgccgccgcgatgcattgcgctgctttgcgtcgctgttcggcgacgaagcgctcgacccc
cttgattatgttgactatcgttggggtacagaggaattcgcgccgggtggtccgaccgcg
gcggtaccgccggggtcgtggacgaaatacggtcactggttacgtgagccggtcggtccg
attcactgggcgagcactgagaccgcggacgaatggaccgggtatttcgacggcgccgtc
agatccggtcagcgtgccgccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system