KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_1156Help
Entry
CFBS_1156         CDS       T02679                                 

Gene name
celA2b
Definition
cellulase CelA2b
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtur00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214328..1214783
Genome map
AA seq 151 aa AA seqDB search
MGTNLPTEVGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQKEIMIWFNHQGS
IQPVGSPVGNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPIT
DSWYLTSIRAGLEPWSDGVGLGVDSFSAKVN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaccaacctgcctactgaggtgggccagattttgtcggcgccgaccagcatcgac
tacaactacccgacgaccggggtatgggacgcctcctacgacatctgcctggattccaca
cccaagacgaccggggtcaaccaaaaggagatcatgatctggttcaaccaccagggctcc
attcagccggtcggctccccggtgggcaacaccaccatcgagggcaagaacttcgtggtg
tgggatggcagcaacggcatgaacaacgcgatggcctatgtcgcgaccgagccgatcgag
gtctggagcttcgacgtgatgagtttcgtcgaccacaccgccaccatggagccgatcacc
gactcgtggtacctcacgagcatccgggccggcttggagccctggagcgacggtgtgggt
ctgggggtcgattcgttctcggcgaaagtcaactaa

DBGET integrated database retrieval system