KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_2623Help
Entry
CFBS_2623         CDS       T02679                                 

Gene name
gdh
Definition
putative NAD-dependent glutamate dehydrogenase Gdh
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mtur00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mtur00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtur00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:mtur00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2773285..2778159)
Genome map
AA seq 1624 aa AA seqDB search
MTIDPGAKQDVEAWTTFTASADIPDWISKAYIDSYRGPRDDSSEATKAAEASWLPASLLT
PAMLGAHYRLGRHRAAGESCVAVYRADDPAGFGPALQVVAEHGGMLMDSVTVLLHRLGIA
YAAILTPVFDVHRSPTGELLRIEPKAEGTSPHLGEAWMHVALSPAVDHKGLAEVERLLPK
VLADVQRVATDATALIATLSELAGEVESNAGGRFSAPDRQDVGELLRWLGDGNFLLLGYQ
RCRVADGMVYGEGSSGMGVLRGRTGSRPRLTDDDKLLVLAQARVGSYLRYGAYPYAIAVR
EYVDGSVVEHRFVGLFSVAAMNADVLEIPTISRRVREALAMAESDPSHPGQLLLDVIQTV
PRPELFTLSAQRLLTMARAVVDLGSQRQALLFLRADRLQYFVSCLVYMPRDRYTTAVRMQ
FEDILVREFGGTRLEFTARVSESPWALMHFMVRLPEVGVAGEGAAAPPVDVSEANRIRIQ
GLLTEAARTWADRLIGAAAAAGSVGQADAMHYAAAFSEAYKQAVTPADAIGDIAVITELT
DDSVKLVFSERDEQGVAQLTWFLGGRTASLSQLLPMLQSMGVVVLEERPFSVTRPDGLPV
WIYQFKISPHPTIPLAPTVAERAATAHRFAEAVTAIWHGRVEIDRFNELVMRAGLTWQQV
VLLRAYAKYLRQAGFPYSQSYIESVLNEHPATVRSLVDLFEALFVPVPSGSASNRDAQAA
AAAVAADIDALVSLDTDRILRAFASLVQATLRTNYFVTRQGSARCRDVLALKLNAQLIDE
LPLPRPRYEIFVYSPRVEGVHLRFGPVARGGLRWSDRRDDFRTEILGLVKAQAVKNAVIV
PVGAKGGFVVKRPPLPTGDPAADRDATRAEGVACYQLFISGLLDVTDNVDHATASVNPPP
EVVRRDGDDAYLVVAADKGTATFSDIANDVAKSYGFWLGDAFASGGSVGYDHKAMGITAR
GAWEAVKRHFREIGIDTQTQDFTVVGIGDMSGDVFGNGMLLSKHIRLIAAFDHRHIFLDP
NPDAAVSWAERRRMFELPRSSWGDYDRSLISEGGGVYSREQKAIPLSAQVRAVLGIDGSV
DGGAAEMAPPNLIRAILRAPVDLLFNGGIGTYIKAESESDADVGDRANDPVRVNANQVRA
KVIGEGGNLGVTALGRVEFDLSGGRINTDALDNSAGVDCSDHEVNIKILIDSLVSAGTVK
ADERTQLLESMTDEVAQLVLADNEDQNDLMGTSRANAASLLPVHAMQIKYLVAERGVNRE
LEALPSEKEIARRSEAGIGLTSPELATLMAHVKLGLKEEVLATELPDQDVFASRLPRYFP
TALRERFTPEIRSHQLRREIVTTMLINDLVDTAGITYAFRIAEDVGVTPIDAVRTYVATD
AIFGVGHIWRRIRAANLPIALSDRLTLDTRRLIDRAGRWLLNYRPQPLAVGAEINRFAAM
VKALTPRMSEWLRGDDKAIVEKTAAEFASQGVPEDLAYRVSTGLYRYSLLDIIDIADIAD
IDAAEVADTYFALMDRLGTDGLLTAVSQLPRHDRWHSLARLAIRDDIYGALRSLCFDVLA
VGEPGESSEQKIAEWEHLSASRVARARRTLDDIRASGQKDLATLSVAARQIRRMTRTSGR
GISG
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatcccggggctaagcaggatgttgaggcgtggaccacgttcaccgcgagt
gcggacattcctgactggatctcgaaggcctacatcgacagctatcgaggaccgcgcgac
gactcgtcggaagccaccaaggccgccgaggccagttggcttccagcctccctgctgacg
cccgccatgctgggcgcacattatcggcttggccggcaccgcgcggccggtgaaagctgt
gtcgccgtctatcgggcggacgatcccgcggggttcggtccggcgctgcaggtggtcgcc
gagcacggcggcatgctgatggattccgttacggtgctgctgcaccggcttggaatcgcc
tacgcggcgattctgaccccggtgttcgacgtgcaccgcagccccacgggagagctgctg
cgcatcgaaccgaaggccgagggcacgtcgccgcacctgggtgaggcctggatgcacgta
gcgctctcgcccgccgttgatcacaaaggcctcgccgaggtggagcggttgctgcccaag
gtgctggccgacgtccagcgggtggccaccgacgccacagcgctgatcgccaccctgagc
gagctggcgggagaagtcgaatccaatgccggcggccgattttccgcgcccgaccgacaa
gacgtcggggaactgttgcgttggctgggtgacgggaacttcctgctgctgggctaccaa
cggtgccgggtggctgacgggatggtctacggcgaggggtcaagcggtatgggcgtcctg
cggggccgcaccggttcgcgtccccggctgaccgacgacgacaaactgctggtgttggcc
caagcgcgggtcggcagctacctgcgttacggcgcctatccctatgccatcgcggtccgc
gaatacgtcgacggcagcgtggtcgagcaccgcttcgtcgggctcttcagcgtcgcggcc
atgaatgcggacgtgctggagatcccgacgatctcgcgccgggtccgcgaggcgctggcg
atggccgaaagcgatcccagccacccaggccaattgctgctcgacgtcatccagaccgtc
ccgcgaccggagctgttcaccctgagcgcgcagcgcctgctgaccatggccagggccgtg
gtggacttgggatcgcaacggcaggcgttgttgttcctgcgcgcggatcggttgcagtac
ttcgtgtcgtgcctggtctacatgccccgagatcgctacaccaccgccgtgcgcatgcaa
ttcgaggacatccttgtccgcgagttcgggggaacacgactggagttcaccgctcgggtc
agtgaatcaccttgggcactcatgcatttcatggtgcggctacccgaagtgggtgtggca
ggagaaggggcggccgccccgccggtggacgtttccgaagccaaccggatccggatccag
ggtctgctgaccgaagccgcgcgaacctgggccgaccgtttgatcggcgcggcggcggcg
gctggctccgtcggacaggccgacgctatgcattacgctgccgccttctccgaggcctac
aaacaggccgtcaccccggccgatgccattggcgacattgcggtcatcacggagctgacc
gacgattcggtcaagctggtgttttccgaacgcgacgagcagggtgtcgcccagttgacc
tggttcctcggtgggcgcaccgcttcgctgagccagctgctgccgatgctgcaaagcatg
ggagtcgtggtgctcgaagagcgaccgttctccgtcacccggccggacggtctgccggtc
tggatctatcagttcaagatctcgccgcatcccacgatcccgttggccccgacggttgcc
gagcgggccgcgaccgcgcaccgattcgccgaggcggtgaccgcgatttggcacggccgg
gtcgaaatcgaccgattcaacgagctggtgatgcgtgccgggctgacttggcagcaggtc
gtgctgctccgtgcctacgcgaagtacctgcgccaggcgggcttcccgtacagccagtcc
tacattgaatcggtgctcaacgagcaccctgctaccgttcggtctttggtcgatctgttc
gaagcgcttttcgttccggtgccgtcggggtcggcgagcaatcgcgatgcccaagcggcc
gctgccgctgtcgccgcggacatcgacgcgctggtgagcctggacaccgaccggatcctg
cgcgccttcgcgtcgttggttcaggccacgttgcgcaccaattactttgtgacacgccag
ggttcggcccgctgccgtgatgtattggcgctgaaactcaatgcccagttgatcgacgaa
cttccgctgccgcgtccccggtacgagatttttgtgtattcgccccgcgtcgaaggcgtg
catctgaggttcggcccagttgcgcgtggcgggttgcgctggtcggaccgccgtgacgat
ttccgaaccgagattctcggattggtcaaggcgcaagcggtgaagaacgccgtcatcgtg
ccggtcggggccaagggcgggttcgtggtcaagcgtcccccgctgcccaccggcgacccc
gccgccgaccgcgacgccacccgcgccgaaggggtcgcctgctatcagctgttcatctcc
gggttgctcgatgtcaccgacaacgtcgatcatgcgaccgcaagcgtcaaccccccgccc
gaggtggtgcgacgtgacggcgacgacgcctacttggtagtggccgccgacaaaggtact
gccaccttttccgatatcgccaacgatgtcgccaagtcctatgggttctggctgggcgac
gcgttcgcctcgggcggatcggtgggctacgaccacaaggccatgggcatcaccgcccgg
ggggcctgggaggccgtaaaacggcatttccgagagatcgggatcgacacccagacccag
gatttcaccgtcgtgggaatcggcgacatgagcggcgacgtattcggcaacggcatgttg
ctgagcaagcacatccggctgatcgccgccttcgaccaccgccacatcttcctcgacccc
aaccccgatgccgcggtgtcgtgggccgaacgccggcggatgttcgagttgccccggtcc
agctggggcgactatgacaggtctctgatcagcgagggcggcggggtgtacagccgcgaa
cagaaagccatcccgctcagcgcgcaggtccgcgccgtcctcggcatcgacggctcagtt
gacgggggggccgccgagatggccccgcccaaccttattcgggcgattctgcgggcgccg
gtggacctgctgttcaacggcggcatcggcacttacatcaaggccgagtcagagtcggat
gctgatgtcggcgatcgcgccaacgatccggtgcgagtcaacgcgaatcaagtgcgcgcc
aaggtcattggcgaaggtggcaatctcggagtgacggcgttgggccgtgtcgaattcgat
ctgtccggcggccggatcaacaccgacgcgctggacaactccgccggcgtggactgctcg
gaccacgaggtcaacatcaagatcctgatcgactcgctggtgagcgccggcacggtcaaa
gccgacgaacgcacacagctgctcgagtcaatgaccgacgaggtagcgcaactggtgctc
gccgacaacgaagatcagaacgacttgatgggcaccagtcgcgccaacgcggccagcctg
ctgccggtgcacgcaatgcagatcaagtatttggtggctgagcgcggggtcaaccgcgaa
ttggaagcgctgccgtcggagaaggagattgcccggcgctccgaggccggcatcgggctc
acctcgcccgaactcgccacgctgatggcgcacgtcaagctggggctcaaagaggaggtg
ctagccaccgaactaccggatcaggatgtcttcgcttccaggttgcctcgttatttcccg
acggcgctgcgcgaacggttcaccccggagatccgttcccaccagctgcgccgcgagatc
gtcaccaccatgctgatcaacgatctggtggataccgccggcatcacctatgcgttccgg
atcgccgaagacgttggtgtcacgccgatcgatgccgtgcgcacctatgtcgccaccgat
gccatcttcggtgtcggtcacatttggcgccggatccgtgcggcgaacctgccaatcgcg
ctgtcagacaggttgacgctggacacccgtcggctgatcgaccgtgccggacgctggctg
ctcaactaccgtccgcagcccttggccgtcggcgccgagatcaaccgattcgcggccatg
gtcaaggcactgacaccgcgcatgtcggagtggttgcgtggtgatgacaaggccatcgtc
gaaaagacagctgcggaattcgcatcgcagggtgtgcctgaagacttggcctaccgtgtc
tcgaccggcctgtaccggtacagcctgctcgacatcatcgacatcgccgacatcgccgac
atcgacgccgccgaggtcgctgacacctatttcgccctgatggaccggctgggcaccgat
ggcctgctgaccgcggtatcccagctgccccgacacgaccgctggcattcgttggcgcgc
ttggcgattcgcgacgatatttacggtgcgctacggtcgttgtgtttcgacgtgctggcc
gtgggggaacccggcgagagtagcgagcaaaagatcgccgagtgggaacacctcagcgcc
tcccgggtggcgcgggcacgtcggacactcgacgacatccgtgccagcggccagaaggat
ctggcgacgttgtcggtcgccgcgcggcagatccgccgcatgacacggacaagcgggcga
ggaatctcggggtga

DBGET integrated database retrieval system