KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_3198Help
Entry
CFBS_3198         CDS       T02679                                 

Definition
(GenBank) hypothetical protein
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur00500  Starch and sucrose metabolism
mtur01100  Metabolic pathways
mtur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFBS_3198
Enzymes [BR:mtur01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CFBS_3198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 DUF1957 EcoEI_R_C
Motif
Other DBs
NCBI-ProteinID: AGM01631
Position
3380119..3381699
Genome map
AA seq 526 aa AA seqDB search
MNTSASPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQVLAALADENRH
RLITLGMTPVVNAQLDDPYCLNGVHHWLANWQLRAEEAASVRYARQSKSADYPSCTPEAL
RAFGIRECADAARALDNFATRWRHGGSPLLRGLIDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAQLRLAHRPKGIWAPECAYAPGMEVDYATAGVSHFMVDGPSLHGDTALGRP
VGKTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEQKA
PYDPERADRAVDVHVADFVDVVRNRLLSESERIGRPAHVIAAFDTELFGHWWYEGPTWLQ
RVLRALPAAGVRVGTLSDAIADGFVGDPVELPPSSWGSGKDWQVWSGAKVADLVQLNSEV
VDTALTTIDKALAQTASLDGPLPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALAAGRRDTARRLAEGWNRADGLFGALDARRLPK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacgtccgcaagcccggtgcccggcctgttcacgcttgttctgcacactcacctg
ccctggctggcccaccacgggcgctggccggtcggcgaggaatggctctatcagtcgtgg
gcggcggcctacctgccgctgctgcaggtgctggccgcgctggccgacgagaaccggcac
cggttgatcaccctcgggatgacgccggtggtcaacgcccagctcgacgacccatactgc
ctcaacggtgtgcatcactggctagccaactggcagctgcgcgccgaagaggccgccagc
gtgcggtatgcccgtcagtcgaagtcggctgactatccgtcatgcacaccggaggcgttg
cgggcctttgggattcgcgaatgtgccgatgcagctcgcgcgctcgacaacttcgccacg
cggtggcggcacggcggcagcccactgctgcgcggcctgatcgacgccggcacggtggag
ctgctcggtggcccacttgcccacccgttccagccgctgctggcaccgcggctgcgcgag
ttcgcgctgcgcgaaggcctcgccgatgctcagctgcggctggcgcaccgcccgaaaggg
atctgggcacccgaatgcgcatacgccccggggatggaggtcgactacgccaccgcgggg
gtcagtcacttcatggtcgacggcccgtcgctgcacggcgacaccgcgctgggccggccg
gtggggaaaaccgatgtggtcgccttcggtcgcgacttgcaggtcagctaccgggtgtgg
tcaccgaaatccggctaccccgggcacgccgcctaccgcgacttccacacctacgaccac
ctgaccggactcaaaccggccagggtcaccgggcgtaacgtgccgtcggagcaaaaggca
ccctacgatcccgagcgcgctgaccgcgccgtcgacgtccatgttgccgatttcgtcgac
gtggtgcgcaatcggctgctctccgagtccgagcgcatcggccggcccgcccacgtgatc
gccgccttcgacaccgagttgttcggccactggtggtacgagggcccaacctggctgcaa
cgggtattgcgggctttacccgccgccggtgtccgggtgggcaccctgagcgatgcgatc
gccgacggattcgtcggcgacccggtcgaattgccacccagctcttggggttccggcaag
gactggcaggtgtggagcggtgccaaggtggccgatctggtccagctcaacagcgaagtg
gtcgataccgcgttgaccaccatcgacaaggcgctggcccagacagcgtccctggacgga
ccgctgcctcgcgatcacgttgctgatcagatcctgcgcgagaccctgctcaccgtgtcc
agcgactggccgttcatggtgagcaaggactccgccgccgactacgcccgctatcgtgct
cacctgcacgcacacgccacccgggagatcgccggcgcgctggccgcgggccgacgcgac
accgcacggcggctcgccgaagggtggaaccgcgccgacggtctgttcggcgccctggac
gctcggaggctgcccaagtga

DBGET integrated database retrieval system