KEGG   Mycobacterium tuberculosis BT1: HKBT1_0902Help
Entry
HKBT1_0902        CDS       T03152                                 

Gene name
fadA
Definition
(GenBank) acyl-CoA thiolase FadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtut00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBT1_0902 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    HKBT1_0902 (fadA)
   00640 Propanoate metabolism
    HKBT1_0902 (fadA)
   00650 Butanoate metabolism
    HKBT1_0902 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    HKBT1_0902 (fadA)
   00072 Synthesis and degradation of ketone bodies
    HKBT1_0902 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBT1_0902 (fadA)
   00310 Lysine degradation
    HKBT1_0902 (fadA)
   00380 Tryptophan metabolism
    HKBT1_0902 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBT1_0902 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBT1_0902 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HKBT1_0902 (fadA)
Enzymes [BR:mtut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBT1_0902 (fadA)
Exosome [BR:mtut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBT1_0902 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
953720..954931
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagggcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcggttccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system