KEGG   Mycobacterium tuberculosis BT2: HKBT2_3733Help
Entry
HKBT2_3733        CDS       T03153                                 

Gene name
ltp3
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBT2_3733 (ltp3)
   00630 Glyoxylate and dicarboxylate metabolism
    HKBT2_3733 (ltp3)
   00640 Propanoate metabolism
    HKBT2_3733 (ltp3)
   00650 Butanoate metabolism
    HKBT2_3733 (ltp3)
  Lipid metabolism
   00071 Fatty acid degradation
    HKBT2_3733 (ltp3)
   00072 Synthesis and degradation of ketone bodies
    HKBT2_3733 (ltp3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBT2_3733 (ltp3)
   00310 Lysine degradation
    HKBT2_3733 (ltp3)
   00380 Tryptophan metabolism
    HKBT2_3733 (ltp3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBT2_3733 (ltp3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBT2_3733 (ltp3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HKBT2_3733 (ltp3)
Enzymes [BR:mtuu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBT2_3733 (ltp3)
Exosome [BR:mtuu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBT2_3733 (ltp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3949461..3950645
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELLMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctactcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system