KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0062Help
Entry
RVBD_0062         CDS       T02178                                 

Definition
cellulase CelA1
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RVBD_0062
Enzymes [BR:mtv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RVBD_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
65549..66691
Genome map
AA seq 380 aa AA seqDB search
MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMSSAIGSVARWIVPLLG
VAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTS
VANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATG
TDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAA
VYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHY
VIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGE
PQAGRFVSQYAIDLAHNAGQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtcggactgggcagcgatggcgcgggactctgcccgggcgccggccttggaca
cggccagcgcccgccacctgtcgtcggcatttggcgtttgtcgaattgcggcattatttt
gctcgggtgatgtcatcagctattggttcggtcgcgcggtggatagtccccctcctgggg
gttgcagccgttgcttccatcggtgttatcgcggacccggtgcgggtcgttcgggccccg
gcgttgatcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatccc
gcctcggcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctcc
gtcgccaacaccccgcagtcctactggctcgaccaggcattcccgccggcgaccgtcggc
ggcacggttgccaggtacaccggagcggcgcaggcggccggcgccatgccggttctgacg
ctgtatggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggc
actgattaccgcgggtggatcgacgctgtcgcatccggcctgggctcatcgccggcgacg
atcatcgtcgaacccgatgcgctggccatggccgactgcctgtcgcctgaccagcgccag
gaacgtttcgacttggtgcgctacgccgtcgacacgctgacccgcgacccggccgctgcc
gtgtacgtcgatgcggggcattcgcgctggctgagcgccgaggcaatggccgccaggctc
aacgatgtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacacc
accgatgaggaaatcggctatggcgaggcgatttcggggctcacgaacggttcgcattac
gtgatcgacacgtcgcgcaacggcgccggacccgcgcccgacgccccgctcaactggtgt
aaccccagcggccgcgccctgggcgcaccgcccaccacggcgaccgcgggcgcgcacgcc
gacgcttacctgtggatcaaacgtcccggggaatcggacggaacctgcggtcgcggggag
cctcaggcgggtcggttcgttagccagtacgccatcgatctggcccacaacgccggccag
tag

DBGET integrated database retrieval system