KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0511Help
Entry
RVBD_0511         CDS       T02178                                 

Definition
uroporphyrin-III C-methyltransferase HemD
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RVBD_0511
Enzymes [BR:mtv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RVBD_0511
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RVBD_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602822..604519
Genome map
AA seq 565 aa AA seqDB search
MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVVALIGTDLPPV
SGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEARSGV
DVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVADVR
IDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVE
TTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLV
PRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNA
VRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPP
YDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVD
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctccggtccgggc
gaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcgctggtgttc
accgatcccgacgtaccggagccggtggtggcgctgatcggcacggatctgccccccgtg
tccggcccggcgcccgccgagccggttgccgggaacggcgatgcggccggcggaggaagt
gcgcaggaacacggccgggccgcgtccgcggtagtctccggtggtcctgacatccgcccg
gcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgttcgggtgtc
gacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatcagcgaggtg
aacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggccgccagcagc
gcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgccgacgtgcgt
atcgaccccgaaaacaccgactgggacgcgctggctgccgcacccgggccgctgatcctg
caggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggcc
gagtccactccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgttcggtcgag
accacacttcagggattgaccgacccggccgtcctgggcgctaccgaccccgcgtgctcc
gcaaacgggagggactcccaggccggaccgctgatagtgaccatcggcaagacggtgacc
agtcgggcaaagctgaactggtgggagagccgcgccctctacggctggacggtgttggtg
ccgcgcaccaaggaccaggccggcgagatgagcgagcggctcacgtcgtacggcgcgctg
ccggtggaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgc
gccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcg
gtgcgtgcggtgtgggagaagttcggcgagttcggtctggatgcccgcgcgttctccggg
gtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttcggaatcagt
cccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccc
tacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccacc
gaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctac
cggaccgtgcgggccgcgccgccgccggccactacccgggaaatgatcaagacgggcggg
tttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggc
aagccgcacgcgcggacgatcatcgcctgcatagggccaaagaccgccgagaccgcagcc
gagttcggcttgcgggtcgatgtccagccggacaccgccgccatcggcccgctggtcgat
gcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaag
aagagccgcaggcgctag

DBGET integrated database retrieval system