KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0512Help
Entry
RVBD_0512         CDS       T02178                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase HemB
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv00860  Porphyrin and chlorophyll metabolism
mtv01100  Metabolic pathways
mtv01110  Biosynthesis of secondary metabolites
mtv01120  Microbial metabolism in diverse environments
Module
mtv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RVBD_0512
Enzymes [BR:mtv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RVBD_0512
Exosome [BR:mtv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RVBD_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: AFN48374
UniProt: P9WMP5
Position
604605..605594
Genome map
AA seq 329 aa AA seqDB search
MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPITSMPGVVQHT
RDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGILNVALRDLAKDLGEATV
LMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAESGAHVVGPSGMMDGQVA
AIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREI
ELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAA
VLESLTGIRRAGADIVLTYWAVDAAGWLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagttcctatccgcggcagcgaccgcgccggctccgctccaccgtcgcgatg
cgccgtctggttgcgcaaacctcgttggagccaaggcatttggtgctgccgatgttcgtt
gccgacggcattgacgagccgcggccgattacctccatgccgggcgtggtacagcacacc
cgggattcgctacgtagggccgcggcagccgcggtggccgccggcgtgggtgggctgatg
cttttcggcgtgccgcgcgaccaggacaaggacggtgtcggttcggcgggcatcgacccc
gacgggatcctcaacgtcgcccttcgcgatctggccaaggacctgggtgaggccacggtg
ttgatggccgacacctgtctggacgagttcaccgaccacgggcactgcggtgtgctcgat
gaccggggccgggtcgataacgacgccaccgtggcccgctatgtggaactggctgtggcg
caagcggaatcgggcgcccacgtggtcggacccagtgggatgatggatggccaggtagcc
gcgatccgggacggtttggacgccgccggctacatcgatgtggtgatcttggcctacgcc
gcgaagtttgcttcggcgttctacggcccgttccgcgaggcggtgagctctagcctgtcc
ggggatcggcgcacctaccagcaggagccgggcaacgccgccgaggcgctgcgtgagatc
gagctcgatctcgacgaaggcgccgacattgtgatggtcaaacccgcgatgggctacctc
gatgtggtggcggccgcggcggacgtctcgccggtcccggtggccgcctatcaggtctcg
ggagagtacgcgatgattcgtgcggcggcggccaataattggatcgatgagcgtgccgcg
gtgctagagtcgctgaccggtatccggcgtgccggcgccgacatcgtgctcacctactgg
gcggtagacgcggcgggctggcttacgtga

DBGET integrated database retrieval system