KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0859Help
Entry
RVBD_0859         CDS       T02178                                 

Definition
(GenBank) acyl-CoA thiolase FadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RVBD_0859
   00630 Glyoxylate and dicarboxylate metabolism
    RVBD_0859
   00640 Propanoate metabolism
    RVBD_0859
   00650 Butanoate metabolism
    RVBD_0859
  Lipid metabolism
   00071 Fatty acid degradation
    RVBD_0859
   00072 Synthesis and degradation of ketone bodies
    RVBD_0859
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVBD_0859
   00310 Lysine degradation
    RVBD_0859
   00380 Tryptophan metabolism
    RVBD_0859
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RVBD_0859
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RVBD_0859
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RVBD_0859
Enzymes [BR:mtv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RVBD_0859
Exosome [BR:mtv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RVBD_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
955080..956291
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQSIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagagcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcggttccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system