KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0905Help
Entry
RVBD_0905         CDS       T02178                                 

Definition
enoyl-CoA hydratase EchA6
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RVBD_0905
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RVBD_0905
   00650 Butanoate metabolism
    RVBD_0905
  Lipid metabolism
   00071 Fatty acid degradation
    RVBD_0905
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVBD_0905
   00310 Lysine degradation
    RVBD_0905
   00360 Phenylalanine metabolism
    RVBD_0905
   00380 Tryptophan metabolism
    RVBD_0905
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RVBD_0905
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RVBD_0905
   00281 Geraniol degradation
    RVBD_0905
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RVBD_0905
   00627 Aminobenzoate degradation
    RVBD_0905
   00930 Caprolactam degradation
    RVBD_0905
Enzymes [BR:mtv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RVBD_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1008210..1008941
Genome map
AA seq 243 aa AA seqDB search
MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGA
DLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQAW
AAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatcacccaggcagaagccgtgctgaccattgagctgcaacgcccggagcgc
cgcaacgccttaaattcccagctggtcgaggagcttacgcaggccatccggaaagccggg
gatggatcggctcgggcgatcgtgctgaccggccaaggcaccgcgttctgcgctggcgcg
gacctgagcggagacgcattcgccgccgattatcccgaccggctcatcgagctgcacaag
gcgatggacgcctccccgatgccagtggtcggcgcgatcaacggtcccgccatcggcgcc
ggcttgcagcttgccatgcaatgcgacctgcgggttgtcgcgcccgatgccttcttccag
tttccgacgtcgaaatacggtctggccctggataactggagcatccgccggctgtcgtcg
ttggttgggcacggacgtgcccgcgcgatgctgctcagcgcggaaaagctgaccgccgag
atcgcactgcacaccggaatggcgaatcgcattggcactttggccgacgcccaggcctgg
gccgccgagatcgccaggctggcaccactggctatccagcacgccaagcgggtgctcaac
gacgacggcgctatcgaggaagcgtggccggcccataaggaactcttcgacaaagcctgg
ggcagccaggatgtcatcgaagcgcaggttgcccggatggaaaagcggccgccgaagttc
caaggggcttaa

DBGET integrated database retrieval system