KEGG   Mycobacterium tuberculosis H37Rv: RVBD_1207Help
Entry
RVBD_1207         CDS       T02178                                 

Definition
dihydropteroate synthase 2 FolP2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1351197..1352153
Genome map
AA seq 318 aa AA seqDB search
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGA
TFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLI
SVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRV
SYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLV
MTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEM
VASIQGVRPPTRTVRGLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcaacaccgccggcctcagccggtcgttcaacaccgccggcgttagccggccat
tcaacaccgccggcgttagccggccattcaacgctgtgcggccgtccagtcgcaggtgat
cgtgcgctgatcatggcgatcgtcaaccgcaccccggattcgttttacgacaagggtgcg
actttcagcgacgcggctgccagagacgcggtccaccgggccgtcgccgacggtgccgac
gtcatcgacgtcggcggtgtcaaagccggcccgggtgaacgcgtcgacgtcgacaccgag
atcacgcggctggtgccgttcatcgaatggctccgcggtgcttacccggaccagctgatc
agtgtcgacacctggcgcgcgcaggtggcgaaggcggcctgcgcggcgggggcggacctg
atcaacgacacctggggtggcgtcgacccggccatgcccgaggtggccgccgagttcggc
gcgggcctggtgtgtgcgcacaccggcggcgcgctgccacgcacgcgacccttccgggtg
agctacggtacgactacccgcggtgtggtggatgctgtgattagccaggtcacagccgcc
gccgagcgggccgtcgcggccggggtggcccgcgagaaggtgttgatcgacccggcacac
gacttcggcaagaacaccttccatgggctgctgctattgcgacacgtggccgatcttgtt
atgaccgggtggcccgtgctgatggctttgagcaacaaggacgttgtcggggagactctg
ggcgtggatttgaccgaacggcttgagggaacgctggcagccaccgcgttggctgcggcc
gccggggcgcgcatgtttcgggtgcatgaggtcgccgccacccggcgggtgctggaaatg
gtggcatcgattcagggggtccggccgccgacgcgcacggtgagaggactcgcatga

DBGET integrated database retrieval system