KEGG   Mycobacterium tuberculosis H37Rv: RVBD_1599Help
Entry
RVBD_1599         CDS       T02178                                 

Definition
histidinol dehydrogenase HisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RVBD_1599
  Amino acid metabolism
   00340 Histidine metabolism
    RVBD_1599
Enzymes [BR:mtv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RVBD_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1799590..1800906
Genome map
AA seq 438 aa AA seqDB search
MLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGV
RPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTILAAARL
LGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSRVGIDAE
AGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTV
HRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVG
PWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLA
TAEDLPAHGEAVRRRFER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccgtatcgacttgcggggagccgagttgacagctgccgagctgcgggccgct
ctgccacgcggcggcgccgatgtggaagccgtgctgccgacggtacggcccattgtggcg
gccgtcgccgagcgcggggccgaggccgcgctggacttcggcgcatcgttcgacggtgtg
cggccccatgccatccgggtgccagacgcagcgctggacgcggcgctggccggactggac
tgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacccgcgccgtgcactccggg
cagcgtcgcaccgacgtcacaaccacactgggcccgggcgcgacggtcaccgagcggtgg
gttccggtcgagcgggtaggcctgtacgtgccggggggcaatgcggtgtacccatccagc
gtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgactcgttggtggtagccagc
ccgccgcaggcgcagtgggatggaatgccgcatccgaccattctggccgcggcccggctg
ctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcggtggcgttgctggcttac
ggcggcaccgacaccgacggcgcagcactgacaccggtcgacatgatcaccgggcctggc
aacatctatgtcacggccgccaagcgactgtgccgttcgcgggtgggcatcgacgccgaa
gcggggccaaccgagatcgctatcctcgccgatcacaccgccgacccggtgcatgtggcc
gccgacctgattagccaggccgaacacgacgagttggctgccagcgtgctggtcactccg
agtgaggacctggccgatgccaccgacgccgaactggctggccagctgcagactacggtg
caccgcgaacgggtgacggccgcgctgaccggacgccaatcggcgatcgtcctggtcgac
gacgtggacgccgccgtcttggtggtgaacgcttacgccgctgagcatttggagattcag
accgccgatgccccgcaggttgccagccggatccgctcggcgggagccattttcgtcggc
ccgtggtccccggtgagcctcggcgactactgcgcgggatccaaccatgtactgccgacc
gcgggctgcgcccggcattccagcggcctgtcggtgcagacgttcctgcgcggcatccac
gtcgtggaatacacggaggcggccctcaaagacgtttccggacacgtgatcacgctcgcc
acggccgaggacttgccggcgcacggtgaggcggtacggcggaggttcgagcgatga

DBGET integrated database retrieval system