KEGG   Mycobacterium tuberculosis H37Rv: RVBD_1781cHelp
Entry
RVBD_1781c        CDS       T02178                                 

Definition
4-alpha-glucanotransferase MalQ
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RVBD_1781c
Enzymes [BR:mtv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RVBD_1781c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2015309..2017483)
Genome map
AA seq 724 aa AA seqDB search
MTELAPSLVELARRFGIATEYTDWTGRQVLVSEATLVAALAALGVPAQTEQQRNDALAAQ
LRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQLEDGTTRAEVVQVDNFTPPFDL
DGRWIGEASFVLPADLPLGYHRVNLRSGDSQASAAVVVTPDWLGLPDKLAGRRAWGLAVQ
LYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPSPYL
PTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRAALK
LVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAETYGDDWHRWPKSLRHPDASGVAD
FVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLGIMADLAVGVHPNGADAWALQDV
LAQGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEQEYRPFRALIQAALRHAGAVRIDHIIG
LFRLWWIPDGAPPTQGTYVRYDHDAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLR
GLLGTSILWFEQDRDCGPAGTPLPAERWREYCLSSVTTHDLPPTAGYLAGDQVRLRESLG
LLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDSEEAVLALYRYLGRTPSRLLAVA
LTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPMLLEDIFTDRRAATLAEAVRAATTSP
MSCW
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgcgccttcgctggtcgaacttgcccgacgattcggcattgccaccgag
tacacggactggactggccggcaggtgctggtctccgaggctacattggtggctgctctt
gccgccctcggcgttcccgcccagaccgaacagcaacgcaatgacgccctggccgcgcag
ctgcgatcctactgggcgcgtccattgccggcgaccatcgtcatgcgcgccggagagcag
acgcagttcagggtgcatgtgaccgatggcgctccggccgacgtgtggttgcagctcgag
gacggcacgacacgtgccgaggtggtgcaggtcgacaatttcaccccgccattcgatctt
gacggacgctggatcggcgaggccagcttcgtgttgcccgccgacctgcccctcggctac
caccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtcgtgacgccg
gattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctggccgtccag
ctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgatttggcgaat
ctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaatcccctgcat
gcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcgccctacctg
ccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccattccggaactc
gtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaacagcacgcc
gaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgcagcactcaag
ctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgccttccgtacc
cgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgagacgtacggc
gatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggtgtcgccgat
ttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtggcagctggac
gagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctgggcatcatg
gcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctgcaggacgtg
ctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactcggccaggac
tggtcgcagccaccgtggcggccggaccggctcgctgagcaggagtaccgaccgtttcgc
gcgctgatccaggccgcgttgcggcacgccggtgcggtacgcatcgaccacatcatcggg
ctgttccggttgtggtggatccccgacggcgcaccgcccacccaaggcacctatgtgcgc
tacgaccacgacgcgatgatcggcatcgtcgccctggaagcccaccgggccggggcggtt
gtcgtcggtgaggatctcggcaccgtcgagccgtgggtacgcgactatctactattgcgg
ggcctgctgggcacctcaattctctggtttgagcaggatcgagattgcgggccggctgga
acaccattgccggccgaacgctggcgggagtactgcttgtcgtcggtgaccacccatgat
ctgccgccgaccgccggctacctggccggcgaccaggtacggctgcgcgagtcccttggg
ttgttaaccaaccccgtggaggcggaactcgaatccgcccgggccgaccgggcagcctgg
atggccgagctgcgccgggtcggactgctggcggacggtgccgagcccgactcggaggag
gccgtcctggctctctaccgctacctgggccgaacgccctcgcggctgttggcagtggcg
ttgaccgatgcggtcggcgaccgccggacgcaaaaccagcctggcaccaccgacgagtac
ccgaactggcgggtgccgctcaccggccccgacggtcagccgatgctgctcgaggacatc
ttcaccgatcgcagggcagccaccttggccgaggcggtgcgcgctgcgacgacctcaccg
atgagctgttggtga

DBGET integrated database retrieval system